Recombinant Full Length Rat Epithelial Cell Adhesion Molecule(Epcam) Protein, His-Tagged
| Cat.No. : | RFL3774RF |
| Product Overview : | Recombinant Full Length Rat Epithelial cell adhesion molecule(Epcam) Protein (O55159) (24-315aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (24-315) |
| Form : | Lyophilized powder |
| AA Sequence : | QKDCVCNNYKLTSRCYENENGECQCTSYGTQNTVICSKLASKCLVMKAEMTHSKSGRRMKPEGAIQNNDGLYDPECDEQGLFKAKQCNGTATCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKERAQPYNFESLHTALQDTFASRYMLNPKFIKSIMYENNVITIDLMQNSSQKTQDDVDIADVAYYFEKDVKGESLFHSSKSMDLRVNGELLDLDPGQTLIYYVDEKAPEFSMQGLTAGIIAVIVVVVLAVIAGIVVLVISTRKRSAKYEKAEIKEMGEIHRELNA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Epcam |
| Synonyms | Epcam; Tacstd1; Epithelial cell adhesion molecule; Ep-CAM; Epithelial glycoprotein 314; EGP314; Protein D5.7A; Tumor-associated calcium signal transducer 1; CD antigen CD326 |
| UniProt ID | O55159 |
| ◆ Recombinant Proteins | ||
| EPCAM-1775R | Recombinant Rat EPCAM Protein, His (Fc)-Avi-tagged | +Inquiry |
| EPCAM-1391HFL | Recombinant Full Length Human EPCAM Protein, C-Flag-tagged | +Inquiry |
| Epcam-7481RA | Recombinant Rat Epcam protein, Fc-tagged, APC labeled | +Inquiry |
| EPCAM-81HP | Recombinant Human EPCAM protein, Fc-tagged, R-PE labeled | +Inquiry |
| Epcam-7481RF | Recombinant Rat Epcam Protein, Fc-tagged, FITC conjugated | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
| EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
| EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
| EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Epcam Products
Required fields are marked with *
My Review for All Epcam Products
Required fields are marked with *
