Recombinant Full Length Human EPCAM Protein, C-Flag-tagged
Cat.No. : | EPCAM-1391HFL |
Product Overview : | Recombinant Full Length Human EPCAM Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 32.7 kDa |
AA Sequence : | MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMK AEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSTCWCVNTAGVRRTDKDTEITCSERVR TYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIA DVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDEKAPEFSMQGLKAGVIAVIVVVVIAVV AGIVVLVISRKKRMAKYEKAEIKEMGEMHRELNATRRLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | ES Cell Differentiation/IPS, Transmembrane |
Full Length : | Full L. |
Gene Name | EPCAM epithelial cell adhesion molecule [ Homo sapiens (human) ] |
Official Symbol | EPCAM |
Synonyms | ESA; KSA; M4S1; MK-1; DIAR5; EGP-2; EGP40; KS1/4; MIC18; TROP1; BerEp4; EGP314; HNPCC8; LYNCH8; MOC-31; Ber-Ep4; TACSTD1 |
Gene ID | 4072 |
mRNA Refseq | NM_002354.3 |
Protein Refseq | NP_002345.2 |
MIM | 185535 |
UniProt ID | P16422 |
◆ Recombinant Proteins | ||
Epcam-2842M | Recombinant Mouse Epcam Protein, Myc/DDK-tagged | +Inquiry |
EPCAM-202CF | Recombinant Monkey EPCAM Protein, His-tagged, FITC conjugated | +Inquiry |
EPCAM-195HAF647 | Recombinant Human EPCAM Protein, His-tagged, Alexa Fluor 647 conjugated | +Inquiry |
EPCAM-786HF | Recombinant Human EpCAM protein, Fc-tagged, FITC-Labeled | +Inquiry |
EPCAM-289H | Recombinant Human EPCAM Protein, DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
EPCAM-001CCL | Recombinant Cynomolgus EPCAM cell lysate | +Inquiry |
EPCAM-1434RCL | Recombinant Rat EPCAM cell lysate | +Inquiry |
EPCAM-2525HCL | Recombinant Human EPCAM cell lysate | +Inquiry |
EPCAM-2143MCL | Recombinant Mouse EPCAM cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All EPCAM Products
Required fields are marked with *
My Review for All EPCAM Products
Required fields are marked with *
0
Inquiry Basket