Recombinant Full Length Rat Gap Junction Alpha-4 Protein(Gja4) Protein, His-Tagged
Cat.No. : | RFL12524RF |
Product Overview : | Recombinant Full Length Rat Gap junction alpha-4 protein(Gja4) Protein (Q03190) (2-333aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-333) |
Form : | Lyophilized powder |
AA Sequence : | GDWGFLEKLLDQVQEHSTVVGKIWLTVLFIFRILILGLAGESVWGDEQSDFECNTAQPGC TNVCYDQAFPISHIRYWVLQFLFVSTPTLIYLGHVIYLSRREERLRQKEGELRALPSKDP HVERALAAIEHQMAKISVAEDGRLRIRGALMGTYVISVLCKSVLEAGFLYGQWRLYGWTM EPVFVCQRAPCPHVVDCYVSRPTEKTIFIIFMLVVGVISLVLNLLELVHLLCRCVSREIK ARRDHDTRPAQGSASDPYPEQVFFYLPMGEGPSSPPCPTYNGLSSTEQNWANLTTEERLT STRPPPFVNAAPQGGQKSSSRPNSSASKKQYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gja4 |
Synonyms | Gja4; Cxn-37; Gap junction alpha-4 protein; Connexin-37; Cx37 |
UniProt ID | Q03190 |
◆ Recombinant Proteins | ||
GJA4-2203R | Recombinant Rat GJA4 Protein, His (Fc)-Avi-tagged | +Inquiry |
GJA4-6370M | Recombinant Mouse GJA4 Protein | +Inquiry |
RFL7509BF | Recombinant Full Length Bovine Gap Junction Alpha-4 Protein(Gja4) Protein, His-Tagged | +Inquiry |
GJA4-2547R | Recombinant Rat GJA4 Protein | +Inquiry |
GJA4-7107C | Recombinant Chicken GJA4 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJA4-5922HCL | Recombinant Human GJA4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gja4 Products
Required fields are marked with *
My Review for All Gja4 Products
Required fields are marked with *
0
Inquiry Basket