Recombinant Full Length Rat Gap Junction Beta-5 Protein(Gjb5) Protein, His-Tagged
Cat.No. : | RFL13172RF |
Product Overview : | Recombinant Full Length Rat Gap junction beta-5 protein(Gjb5) Protein (P28232) (1-271aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-271) |
Form : | Lyophilized powder |
AA Sequence : | MNWSVFEGLLSGVNKYSTAFGRIWLSLVFVFRVLVYLVTAERVWGDDQKDFDCNTRQPGC TNVCYDEFFPVSHVRLWALQLILVTCPSLLVVMHVAYRKAREKKYQQEVGKGYLYPNPGK KRGGLWWTYVCSLLFKATIDIIFLYLFHAFYPRYTLPSMVKCHSAPCPNTVDCFIAKPSE KNIFIVFMLVTAIVCILLNLVELLYLVIKRCSECAPAKRPPTAHAKNDPNWANPSSKEKD FLSSDLIFLGSDTHPPLLPDRPRAHVKKTIL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gjb5 |
Synonyms | Gjb5; Cxn-31.1; Gap junction beta-5 protein; Connexin-31.1; Cx31.1 |
UniProt ID | P28232 |
◆ Recombinant Proteins | ||
GJB5-2211R | Recombinant Rat GJB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
GJB5-4932H | Recombinant Human GJB5 Protein, GST-tagged | +Inquiry |
GJB5-2555R | Recombinant Rat GJB5 Protein | +Inquiry |
RFL13172RF | Recombinant Full Length Rat Gap Junction Beta-5 Protein(Gjb5) Protein, His-Tagged | +Inquiry |
GJB5-3575M | Recombinant Mouse GJB5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
GJB5-707HCL | Recombinant Human GJB5 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gjb5 Products
Required fields are marked with *
My Review for All Gjb5 Products
Required fields are marked with *
0
Inquiry Basket