Recombinant Full Length Rat Igg Receptor Fcrn Large Subunit P51(Fcgrt) Protein, His-Tagged
Cat.No. : | RFL8267RF |
Product Overview : | Recombinant Full Length Rat IgG receptor FcRn large subunit p51(Fcgrt) Protein (P13599) (23-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (23-366) |
Form : | Lyophilized powder |
AA Sequence : | AEPRLPLMYHLAAVSDLSTGLPSFWATGWLGAQQYLTYNNLRQEADPCGAWIWENQVSWYWEKETTDLKSKEQLFLEAIRTLENQINGTFTLQGLLGCELAPDNSSLPTAVFALNGEEFMRFNPRTGNWSGEWPETDIVGNLWMKQPEAARKESEFLLTSCPERLLGHLERGRQNLEWKEPPSMRLKARPGNSGSSVLTCAAFSFYPPELKFRFLRNGLASGSGNCSTGPNGDGSFHAWSLLEVKRGDEHHYQCQVEHEGLAQPLTVDLDSPARSSVPVVGIILGLLLVVVAIAGGVLLWNRMRSGLPAPWLSLSGDDSGDLLPGGNLPPEAEPQGVNAFPATS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Fcgrt |
Synonyms | Fcgrt; Fcrn; IgG receptor FcRn large subunit p51; FcRn; IgG Fc fragment receptor transporter alpha chain; Neonatal Fc receptor |
UniProt ID | P13599 |
◆ Recombinant Proteins | ||
RFL8267RF | Recombinant Full Length Rat Igg Receptor Fcrn Large Subunit P51(Fcgrt) Protein, His-Tagged | +Inquiry |
FCGRT-3057H | Recombinant Human FCGRT protein, His-tagged | +Inquiry |
FCGRT-1678R | Recombinant Rhesus monkey FCGRT Protein, His-tagged | +Inquiry |
FCGRT-376H | Recombinant Human FCGRT Protein, AVI-tagged | +Inquiry |
FCGRT-33H | Recombinant Human FCGRT Protein, Ala24-Ser297, C-6×His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
FCGRT-6278HCL | Recombinant Human FCGRT 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Fcgrt Products
Required fields are marked with *
My Review for All Fcgrt Products
Required fields are marked with *
0
Inquiry Basket