Recombinant Full Length Rat Inhibitor Of Nuclear Factor Kappa-B Kinase-Interacting Protein(Ikbip) Protein, His-Tagged
| Cat.No. : | RFL4782RF |
| Product Overview : | Recombinant Full Length Rat Inhibitor of nuclear factor kappa-B kinase-interacting protein(Ikbip) Protein (Q5EAJ6) (1-373aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-373) |
| Form : | Lyophilized powder |
| AA Sequence : | MSEVKSRKKPGPKVAAPEPEKRSDGRKNPEARGGAGWADPRTGLSLLSLATSLGLAWLVF QQSEKFAKVENQYRLLQTESSEFQGLQSKISLISNKLESTENTLQEATSSMSLMTQFEQE VAGLQRSIHDIENSEEMLTQKLQNLNEKFQNITDLWKRTLVEMSDNTAVFKSEAKSTHSE VTLKINSAEQEIKLLTERLKDLEDSTLRNIRTVSRQEEEDLLRVEAQLSSDTKAVEKLEE EQRTLLARDEDLTDKLSSYEPKVEECKAHLPTIENAVHSVLRVSQDLIGTERKMEELTVQ MFNMEDDMLKAVSEIMEMQNTLEGIQYDNSLLKMQNELVVLKGKVHDFMAYSSAGEKGTL EEYNLENKGTDDY |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Ikbip |
| Synonyms | Ikbip; Ikip; Inhibitor of nuclear factor kappa-B kinase-interacting protein; I kappa-B kinase-interacting protein; IKBKB-interacting protein; IKK-interacting protein |
| UniProt ID | Q5EAJ6 |
| ◆ Recombinant Proteins | ||
| IKBIP-2675R | Recombinant Rat IKBIP Protein, His (Fc)-Avi-tagged | +Inquiry |
| Ikbip-2010R | Recombinant Rat Ikbip protein, His & T7-tagged | +Inquiry |
| IKBIP-512H | Recombinant Human IKBIP Protein, MYC/DDK-tagged | +Inquiry |
| RFL8050HF | Recombinant Full Length Human Inhibitor Of Nuclear Factor Kappa-B Kinase-Interacting Protein(Ikbip) Protein, His-Tagged | +Inquiry |
| IKBIP-3020R | Recombinant Rat IKBIP Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| IKBIP-5254HCL | Recombinant Human IKBIP 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ikbip Products
Required fields are marked with *
My Review for All Ikbip Products
Required fields are marked with *
