Recombinant Full Length Rat Leukocyte Surface Antigen Cd53(Cd53) Protein, His-Tagged
Cat.No. : | RFL9289RF |
Product Overview : | Recombinant Full Length Rat Leukocyte surface antigen CD53(Cd53) Protein (P24485) (2-219aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (2-219) |
Form : | Lyophilized powder |
AA Sequence : | GMSSLKLLKYVLFFFNFLFWVCGCCILGFGIHLLVQNTYGILFRNLPFLTLGNVLVIVGS IIMVVAFLGCMGSIKENKCLLMSFFVLLLLILLAEVTLAILLFVYEKKINTLVAEGLNDS IQHYHSDNSTRMAWDFIQSQLQCCGVNGSSDWISGPPSSCPSGADVQGCYKKGQAWFHSN FLYIGIVTICVCVIQVLGMSFALTLNCQIDKTSQALGL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cd53 |
Synonyms | Cd53; Ox-44; Leukocyte surface antigen CD53; Cell surface glycoprotein CD53; Leukocyte antigen MRC OX-44; CD antigen CD53 |
UniProt ID | P24485 |
◆ Recombinant Proteins | ||
LALBA-3327H | Recombinant Human LALBA Protein, His (Fc)-Avi-tagged | +Inquiry |
NPR1-6043H | Recombinant Human NPR1 Protein, GST-tagged | +Inquiry |
MTUS1-3820R | Recombinant Rat MTUS1 Protein | +Inquiry |
cas9-23HFL | Active Recombinant Full Length Streptococcus pyogenes cas9 Protein, N-His-tagged | +Inquiry |
IL25-149M | Recombinant Mouse IL25, His tagged | +Inquiry |
◆ Native Proteins | ||
FLNA-873T | Native Turkey FLNA Protein | +Inquiry |
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
Pectin-008A | Native Apple or Citrus fruits Pectin | +Inquiry |
IgG-355S | Native Sheep IgG | +Inquiry |
Fga-63R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
TSTD2-690HCL | Recombinant Human TSTD2 293 Cell Lysate | +Inquiry |
RXFP3-1553HCL | Recombinant Human RXFP3 cell lysate | +Inquiry |
SLC6A15-1706HCL | Recombinant Human SLC6A15 293 Cell Lysate | +Inquiry |
LMAN2L-1161HCL | Recombinant Human LMAN2L cell lysate | +Inquiry |
CTNS-7199HCL | Recombinant Human CTNS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cd53 Products
Required fields are marked with *
My Review for All Cd53 Products
Required fields are marked with *
0
Inquiry Basket