Recombinant Full Length Rat Lysophosphatidic Acid Receptor 6(Lpar6) Protein, His-Tagged
Cat.No. : | RFL6550RF |
Product Overview : | Recombinant Full Length Rat Lysophosphatidic acid receptor 6(Lpar6) Protein (Q4G072) (1-344aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-344) |
Form : | Lyophilized powder |
AA Sequence : | MVSANGSHCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLA MSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVY PFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTY LSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRSKMNKTKVLKMIFVHLVIFCF CFVPYNINLILYSLVRTQTFVNCSVGAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQN SIKMKSWSVRRSDSRFSEVQGTENFIQHNLQTLKNKIFDNESAI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Lpar6 |
Synonyms | Lpar6; P2ry5; P2y5; Lysophosphatidic acid receptor 6; LPA receptor 6; LPA-6; Oleoyl-L-alpha-lysophosphatidic acid receptor; P2Y purinoceptor 5; P2Y5; Purinergic receptor 5 |
UniProt ID | Q4G072 |
◆ Recombinant Proteins | ||
LPAR6-9194M | Recombinant Mouse LPAR6 Protein | +Inquiry |
LPAR6-3436R | Recombinant Rat LPAR6 Protein | +Inquiry |
LPAR6-6753C | Recombinant Chicken LPAR6 | +Inquiry |
RFL22023HF | Recombinant Full Length Human Lysophosphatidic Acid Receptor 6(Lpar6) Protein, His-Tagged | +Inquiry |
LPAR6-2361R | Recombinant Rhesus Macaque LPAR6 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Lpar6 Products
Required fields are marked with *
My Review for All Lpar6 Products
Required fields are marked with *
0
Inquiry Basket