Recombinant Full Length Rat Membrane Magnesium Transporter 1(Mmgt1) Protein, His-Tagged
Cat.No. : | RFL29963RF |
Product Overview : | Recombinant Full Length Rat Membrane magnesium transporter 1(Mmgt1) Protein (B5DF51) (21-131aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (21-131) |
Form : | Lyophilized powder |
AA Sequence : | AFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSELKNKTFDTLRNHPSFYVFNHRGRVLFRPSDATNSSNLDALSSNTSLKLRKFDSLRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mmgt1 |
Synonyms | Mmgt1; Emc5; Tmem32; ER membrane protein complex subunit 5; Membrane magnesium transporter 1; Transmembrane protein 32 |
UniProt ID | B5DF51 |
◆ Recombinant Proteins | ||
MMGT1-11637Z | Recombinant Zebrafish MMGT1 | +Inquiry |
MMGT1-5594M | Recombinant Mouse MMGT1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MMGT1-035H | Recombinant Human MMGT1 protein, HIS-tagged | +Inquiry |
RFL29963RF | Recombinant Full Length Rat Membrane Magnesium Transporter 1(Mmgt1) Protein, His-Tagged | +Inquiry |
MMGT1-3708R | Recombinant Rat MMGT1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MMGT1-864HCL | Recombinant Human MMGT1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Mmgt1 Products
Required fields are marked with *
My Review for All Mmgt1 Products
Required fields are marked with *