Recombinant Full Length Rat Mitochondrial 2-Oxoglutarate/Malate Carrier Protein(Slc25A11) Protein, His-Tagged
Cat.No. : | RFL2217RF |
Product Overview : | Recombinant Full Length Rat Mitochondrial 2-oxoglutarate/malate carrier protein(Slc25a11) Protein (P97700) (2-314aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-314) |
Form : | Lyophilized powder |
AA Sequence : | AATASPGAGRMDGKPRTSPKSVKFLFGGLAGMGATVFVQPLDLVXNRMQLSGEGAKTREY KTSFHALTSILKAEGLRGIYTGLSAGLLRQATYTTTRLGIYTVLFERLTGADGTPPGFLL KALIGMTAGATGAFVGPPAEVALIRMTADGRLPADQRRGYKNVFNALIRIAREEGVPTLW RGCIPTMARAVVVNAAQLASYSQSKQFLLDSGYFSDNILCHFCAIMISGLVTTAASMPVD IVKTRIQNMRMIDEKPEYKNGLDVLLKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLE QMNKAYKRLFLSG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc25a11 |
Synonyms | Slc25a11; Slc20a4; Mitochondrial 2-oxoglutarate/malate carrier protein; OGCP; Solute carrier family 25 member 11 |
UniProt ID | P97700 |
◆ Recombinant Proteins | ||
SLC25A11-330Z | Recombinant Zebrafish SLC25A11 | +Inquiry |
SLC25A11-5469R | Recombinant Rat SLC25A11 Protein | +Inquiry |
SLC25A11-5128R | Recombinant Rat SLC25A11 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC25A11-1685H | Recombinant Human SLC25A11 protein, His & T7-tagged | +Inquiry |
SLC25A11-0287H | Recombinant Human SLC25A11 Protein (A2-G314), 8×His-MBP, Flag tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC25A11-1784HCL | Recombinant Human SLC25A11 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Slc25a11 Products
Required fields are marked with *
My Review for All Slc25a11 Products
Required fields are marked with *
0
Inquiry Basket