Recombinant Full Length Rat Mitochondrial Inner Membrane Organizing System Protein 1(Minos1) Protein, His-Tagged
| Cat.No. : | RFL14279RF |
| Product Overview : | Recombinant Full Length Rat Mitochondrial inner membrane organizing system protein 1(Minos1) Protein (B2RYW8) (1-76aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-76) |
| Form : | Lyophilized powder |
| AA Sequence : | MSESEPGRKWDRCMADALVKLGTGFGLGMVFSLTFFKRRKWPLAFGSGVGLGMAYSNCQH DFQAPYLLHGKYVKEQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Minos1 |
| Synonyms | Micos10; Mic10; Minos1; MICOS complex subunit Mic10; Mitochondrial inner membrane organizing system protein 1 |
| UniProt ID | B2RYW8 |
| ◆ Recombinant Proteins | ||
| MINOS1-4890H | Recombinant Human MINOS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| MINOS1-7254Z | Recombinant Zebrafish MINOS1 | +Inquiry |
| MINOS1-3688R | Recombinant Rat MINOS1 Protein | +Inquiry |
| MINOS1-5239C | Recombinant Chicken MINOS1 | +Inquiry |
| RFL1502MF | Recombinant Full Length Mouse Mitochondrial Inner Membrane Organizing System Protein 1(Minos1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| MINOS1-8178HCL | Recombinant Human C1orf151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Minos1 Products
Required fields are marked with *
My Review for All Minos1 Products
Required fields are marked with *



