Recombinant Human MINOS1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : MINOS1-4890H
Product Overview : C1orf151 MS Standard C13 and N15-labeled recombinant protein (NP_001027535) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane.
Molecular Mass : 8.8 kDa
AA Sequence : MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name MINOS1 mitochondrial inner membrane organizing system 1 [ Homo sapiens (human) ]
Official Symbol MINOS1
Synonyms MINOS1; mitochondrial inner membrane organizing system 1; C1orf151, chromosome 1 open reading frame 151; mitochondrial inner membrane organizing system protein 1; FLJ36999; MIO10; RP5 1056L3.2; UPF0327 protein C1orf151; C1orf151; RP5-1056L3.2; FLJ75158;
Gene ID 440574
mRNA Refseq NM_001032363
Protein Refseq NP_001027535
MIM 616574
UniProt ID Q5TGZ0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All MINOS1 Products

Required fields are marked with *

My Review for All MINOS1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon