Recombinant Human MINOS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | MINOS1-4890H |
| Product Overview : | C1orf151 MS Standard C13 and N15-labeled recombinant protein (NP_001027535) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. |
| Molecular Mass : | 8.8 kDa |
| AA Sequence : | MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | MINOS1 mitochondrial inner membrane organizing system 1 [ Homo sapiens (human) ] |
| Official Symbol | MINOS1 |
| Synonyms | MINOS1; mitochondrial inner membrane organizing system 1; C1orf151, chromosome 1 open reading frame 151; mitochondrial inner membrane organizing system protein 1; FLJ36999; MIO10; RP5 1056L3.2; UPF0327 protein C1orf151; C1orf151; RP5-1056L3.2; FLJ75158; |
| Gene ID | 440574 |
| mRNA Refseq | NM_001032363 |
| Protein Refseq | NP_001027535 |
| MIM | 616574 |
| UniProt ID | Q5TGZ0 |
| ◆ Cell & Tissue Lysates | ||
| MINOS1-8178HCL | Recombinant Human C1orf151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MINOS1 Products
Required fields are marked with *
My Review for All MINOS1 Products
Required fields are marked with *
