Recombinant Human MINOS1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | MINOS1-4890H |
Product Overview : | C1orf151 MS Standard C13 and N15-labeled recombinant protein (NP_001027535) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | Component of the MICOS complex, a large protein complex of the mitochondrial inner membrane that plays crucial roles in the maintenance of crista junctions, inner membrane architecture, and formation of contact sites to the outer membrane. |
Molecular Mass : | 8.8 kDa |
AA Sequence : | MSESELGRKWDRCLADAVVKIGTGFGLGIVFSLTFFKRRMWPLAFGSGMGLGMAYSNCQHDFQAPYLLHGKYVKEQEQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | MINOS1 mitochondrial inner membrane organizing system 1 [ Homo sapiens (human) ] |
Official Symbol | MINOS1 |
Synonyms | MINOS1; mitochondrial inner membrane organizing system 1; C1orf151, chromosome 1 open reading frame 151; mitochondrial inner membrane organizing system protein 1; FLJ36999; MIO10; RP5 1056L3.2; UPF0327 protein C1orf151; C1orf151; RP5-1056L3.2; FLJ75158; |
Gene ID | 440574 |
mRNA Refseq | NM_001032363 |
Protein Refseq | NP_001027535 |
MIM | 616574 |
UniProt ID | Q5TGZ0 |
◆ Recombinant Proteins | ||
MINOS1-3344R | Recombinant Rat MINOS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MINOS1-5562M | Recombinant Mouse MINOS1 Protein, His (Fc)-Avi-tagged | +Inquiry |
MINOS1-5239C | Recombinant Chicken MINOS1 | +Inquiry |
MINOS1-7254Z | Recombinant Zebrafish MINOS1 | +Inquiry |
MINOS1-4890H | Recombinant Human MINOS1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MINOS1-8178HCL | Recombinant Human C1orf151 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All MINOS1 Products
Required fields are marked with *
My Review for All MINOS1 Products
Required fields are marked with *