Recombinant Full Length Rat Mucosal Addressin Cell Adhesion Molecule 1(Madcam1) Protein, His-Tagged
Cat.No. : | RFL24887RF |
Product Overview : | Recombinant Full Length Rat Mucosal addressin cell adhesion molecule 1(Madcam1) Protein (O70540) (20-394aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (20-394) |
Form : | Lyophilized powder |
AA Sequence : | QSFQVNPPEPEVAVAMGTSLQINCSMSCDKDIARVHWHGLDTNLGNVQTLPGSRVLSVRGMLSDTGTRVCVGSCGSRSFQHSVKILVYAFPDQLEVTPEFLVPGRDQVVSCTAHNIWPAGPDSLSFALLRGEQSLEGAQALETEQEEEMQETEGTPLFQVTQRWLLPSLGTPALPALYCQVTMQLPKLVLTHRRKIPVLQSQTSPEPPSTTSAKPYILTSSHTTKAVSTGLSSVALPSTPLSSEGPCYPEIHQNPEADWELLCEASCGSGVTVHWTLAPGDLAAYHKREAGAQAWLSVLPLGPIPEGWFQCRMDPGGQVTSLYVTGQVIPNPSSMVALWIGSLVLGLLALAFLAYCLWKRYRPGPLPDSSSCTLL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Madcam1 |
Synonyms | Madcam1Mucosal addressin cell adhesion molecule 1; MAdCAM-1; rMAdCAM-1 |
UniProt ID | O70540 |
◆ Recombinant Proteins | ||
MADCAM1-5196H | Recombinant Human MADCAM1 Protein (Met1-Leu318), C-Fc tagged | +Inquiry |
Madcam1-1767M | Recombinant Mouse Mucosal Vascular Addressin Cell Adhesion Molecule 1 | +Inquiry |
MADCAM1-3982H | Recombinant Human MADCAM1 protein, His-tagged | +Inquiry |
MADCAM1-123H | Recombinant Human MADCAM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Madcam1-4509M | Recombinant Mouse Madcam1 protein, His-SUMO-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Madcam1 Products
Required fields are marked with *
My Review for All Madcam1 Products
Required fields are marked with *
0
Inquiry Basket