Recombinant Full Length Rat Olfactory Receptor 51E2(Or51E2) Protein, His-Tagged
Cat.No. : | RFL7996RF |
Product Overview : | Recombinant Full Length Rat Olfactory receptor 51E2(Or51e2) Protein (O88628) (1-320aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-320) |
Form : | Lyophilized powder |
AA Sequence : | MSSCNFTHATFMLIGIPGLEEAHFWFGFPLLSMYAVALFGNCIVVFIVRTERSLHAPMYL FLCMLAAIDLALSTSTMPKILALFWFDSREITFDACLAQMFFIHALSAIESTILLAMAFD RYVAICHPLRHAAVLNNTVTVQIGMVALVRGSLFFFPLPLLIKRLAFCHSNVLSHSYCVH QDVMKLAYTDTLPNVVYGLTAILLVMGVDVMFISLSYFLIIRAVLQLPSKSERAKAFGTC VSHIGVVLAFYVPLIGLSVVHRFGNSLDPIVHVLMGDVYLLLPPVINPIIYGAKTKQIRT RVLAMFKISCDKDIEAGGNT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Or51e2 |
Synonyms | Or51e2; Olr59; Psgr; Olfactory receptor 51E2; G-protein coupled receptor RA1c; Olfactory receptor 59 |
UniProt ID | O88628 |
◆ Recombinant Proteins | ||
OR51E2-3034R | Recombinant Rhesus Macaque OR51E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
OR51E2-16H | Recombinant Human OR51E2 Full Length Transmembrane protein, His-tagged(VLP) | +Inquiry |
OR51E2-1585H | Recombinant Human OR51E2 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL7996RF | Recombinant Full Length Rat Olfactory Receptor 51E2(Or51E2) Protein, His-Tagged | +Inquiry |
OR51E2-3216R | Recombinant Rhesus monkey OR51E2 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OR51E2-3558HCL | Recombinant Human OR51E2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Or51e2 Products
Required fields are marked with *
My Review for All Or51e2 Products
Required fields are marked with *