Recombinant Full Length Rat Oxidized Low-Density Lipoprotein Receptor 1(Olr1) Protein, His-Tagged
Cat.No. : | RFL17489RF |
Product Overview : | Recombinant Full Length Rat Oxidized low-density lipoprotein receptor 1(Olr1) Protein (O70156) (1-364aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-364) |
Form : | Lyophilized powder |
AA Sequence : | MAFDDKMKPVNGQPDQKSCGKKPKGLHLLSSTWWCPAAVTLAILCLVLSVTLIVQQTQLLQVSDLLKQYQANLTQQDHILEGQMSAQKKAENASQESKRELKEQIDTLTWKLNEKSKEQEKLLQQNQNLQEALQRAVNASEESKWELKEQIDILNWKLNGISKEQKELLQQNQNLQEALQKAEKYSEESQRELKEQIDTLSWKLNEKSKEQEELLQQNQNLQEALQRAANSSGPCPQDWIWHKENCYLFHGPFNWEKSRENCLSLDAQLLQISTTDDLNFVLQATSHSTSPFWMGLHRKNPNHPWLWENGSPLSFQFFRTRGVSLQMYSSGTCAYIQGGVVFAENCILTAFSICQKKANLLLTQ |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Olr1 |
Synonyms | Olr1; Lox1; Oldlr1; Oxidized low-density lipoprotein receptor 1; Ox-LDL receptor 1; Lectin-like oxidized LDL receptor 1; LOX-1; Lectin-like oxLDL receptor 1; Lectin-type oxidized LDL receptor 1 |
UniProt ID | O70156 |
◆ Recombinant Proteins | ||
OLR1-3306H | Recombinant Human OLR1 protein, His-tagged | +Inquiry |
OLR1-8842C | Recombinant Cynomolgus OLR1, His tagged | +Inquiry |
Olr1-1887R | Recombinant Rat Olr1 protein, His & T7-tagged | +Inquiry |
OLR1-061H | Recombinant Human OLR1 protein, His-Avi-tagged | +Inquiry |
OLR1-2984R | Recombinant Rhesus Macaque OLR1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
OLR1-1716HCL | Recombinant Human OLR1 cell lysate | +Inquiry |
OLR1-1170CCL | Recombinant Cynomolgus OLR1 cell lysate | +Inquiry |
OLR1-001RCL | Recombinant Rat OLR1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Olr1 Products
Required fields are marked with *
My Review for All Olr1 Products
Required fields are marked with *