Recombinant Full Length Rat Peroxisome Biogenesis Factor 2(Pex2) Protein, His-Tagged
Cat.No. : | RFL2487RF |
Product Overview : | Recombinant Full Length Rat Peroxisome biogenesis factor 2(Pex2) Protein (P24392) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-305) |
Form : | Lyophilized powder |
AA Sequence : | MAAREESTQSANRVLRISQLDALELNKALEQLVWSQFTQCFHGFKPGLLARFEPEVKAFL WLFLWRFTIYSKNATVGQSVLNIQYKNDSSPNPVYQPPSKNQKLLYAVCTIGGRWLEERC YDLFRNRHLASFGKAKQCMNFVVGLLKLGELMNFLIFLQKGKFATLTERLLGIHSVFCKP QSMREVGFEYMNRELLWHGFAEFLVFLLPLINIQKLKAKLSSWCIPLTSTAGSDSTLGSS GKECALCGEWPTMPHTIGCEHVFCYYCVKSSFLFDMYFTCPKCGTEVHSVQPLKSGIEMS EVNAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pex2 |
Synonyms | Pex2; Paf1; Pmp35; Pxmp3; Peroxisome biogenesis factor 2; Peroxin-2; Peroxisomal membrane protein 3; Peroxisome assembly factor 1; PAF-1 |
UniProt ID | P24392 |
◆ Recombinant Proteins | ||
RFL2376DF | Recombinant Full Length Dictyostelium Discoideum Peroxisome Biogenesis Factor 2(Pex2) Protein, His-Tagged | +Inquiry |
PEX2-2640H | Recombinant Human PEX2 protein, His-tagged | +Inquiry |
PEX2-4383R | Recombinant Rat PEX2 Protein | +Inquiry |
PEX2-4043R | Recombinant Rat PEX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
PEX2-6648M | Recombinant Mouse PEX2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX2-3288HCL | Recombinant Human PEX2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pex2 Products
Required fields are marked with *
My Review for All Pex2 Products
Required fields are marked with *