Recombinant Full Length Rat Phosphatidylinositol-Glycan Biosynthesis Class X Protein(Pigx) Protein, His-Tagged
| Cat.No. : | RFL6771RF |
| Product Overview : | Recombinant Full Length Rat Phosphatidylinositol-glycan biosynthesis class X protein(Pigx) Protein (Q60GF7) (23-252aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (23-252) |
| Form : | Lyophilized powder |
| AA Sequence : | DISDARFSDGVRATCSEIILRQEFLKDGFHRDLLIKVKFGESIEDLQTCRLLIKHYIPTG LFVDPYELASLRERNITEAVMVSESFNLEAPNYLSTESAVLIYARQDAQCIDCFQAFLPV HYRYHRPHKKDGDTLIVVNNPDLLMHCDQEFPILKCWAQSEVAAPCSLKSEEICQWKNMQ YKSILKNLTVQVPVGLTIHTSLVCSVTLLITVLCSTLILLAVFKYGHFSL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Pigx |
| Synonyms | Pigx; Phosphatidylinositol-glycan biosynthesis class X protein; PIG-X |
| UniProt ID | Q60GF7 |
| ◆ Recombinant Proteins | ||
| PIGX-4115R | Recombinant Rat PIGX Protein, His (Fc)-Avi-tagged | +Inquiry |
| PIGX-4711H | Recombinant Human PIGX protein, His-SUMO-tagged | +Inquiry |
| Pigx-4857M | Recombinant Mouse Pigx Protein, Myc/DDK-tagged | +Inquiry |
| PIGX-1712H | Recombinant Human PIGX, His-tagged | +Inquiry |
| RFL6771RF | Recombinant Full Length Rat Phosphatidylinositol-Glycan Biosynthesis Class X Protein(Pigx) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| PIGX-3194HCL | Recombinant Human PIGX 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Pigx Products
Required fields are marked with *
My Review for All Pigx Products
Required fields are marked with *
