Recombinant Full Length Rat Prenylated Rab Acceptor Protein 1(Rabac1) Protein, His-Tagged
Cat.No. : | RFL6979RF |
Product Overview : | Recombinant Full Length Rat Prenylated Rab acceptor protein 1(Rabac1) Protein (O35394) (1-185aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-185) |
Form : | Lyophilized powder |
AA Sequence : | MAAQKDQQKDAEVEGLSATTLLPKLIPSGAGREWLERRRATIRPWGTFVDQQRFSRPRNV GELCQRLVRNVEYYQSNYVFVFLGLILYCVVTSPMLLVALAVFFGACYILYLRTLQSKLV LFGREVSPAHQYALAGGVSFPFFWLAGAGSAVFWVLGATLVLIGSHAAFHQIEPADGEEL QMEPV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rabac1 |
Synonyms | Rabac1; Pra1; Praf1; Prenylated Rab acceptor protein 1; PRA1 family protein 1 |
UniProt ID | O35394 |
◆ Recombinant Proteins | ||
RABAC1-2138H | Recombinant Human RABAC1, GST-tagged | +Inquiry |
RABAC1-3764R | Recombinant Rhesus monkey RABAC1 Protein, His-tagged | +Inquiry |
RABAC1-12796Z | Recombinant Zebrafish RABAC1 | +Inquiry |
RFL17458CF | Recombinant Full Length Dog Prenylated Rab Acceptor Protein 1(Rabac1) Protein, His-Tagged | +Inquiry |
RFL30797HF | Recombinant Full Length Human Prenylated Rab Acceptor Protein 1(Rabac1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RABAC1-2576HCL | Recombinant Human RABAC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Rabac1 Products
Required fields are marked with *
My Review for All Rabac1 Products
Required fields are marked with *