Recombinant Full Length Rat Prostaglandin D2 Receptor 2(Ptgdr2) Protein, His-Tagged
Cat.No. : | RFL26992RF |
Product Overview : | Recombinant Full Length Rat Prostaglandin D2 receptor 2(Ptgdr2) Protein (Q6XKD3) (1-403aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-403) |
Form : | Lyophilized powder |
AA Sequence : | MANITLKPLCPLLEEMVQLPNHSNSSLRYIDHVSVLLHGLASLLGLVENGLILFVVGCRM RQTVVTTWVLHLALSDLLAAASLPFFTYFLAVGHSWELGTTFCKLHSSVFFLNMFASGFL LSAISLDRCLQVVRPVWAQNHRTVAAAHRVCLMLWALAVLNTVPYFVFRDTIPRRDGRIM CYYNMLLLNPGSDRDTTCDYRQKALAVSKFLLAFMVPLAIIASSHVAVSLQLHHRGRQRT GRFVRLVAAIVVAFILCWGPYHIFSLLEARAHSVTTLRQLASRGLPFVTSLAFFNSVVNP LLYVLTCPDMLHKLRRSLLTVLESVLVEDSDLSTGPGKRCRRRHRRRASSTTTPASTLLL ADRFPQLRPARLIGWMRRGSAELPRRVREQSQEKQGSLSCTLD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Ptgdr2 |
Synonyms | Ptgdr2; Crth2; Gpr44; Prostaglandin D2 receptor 2; G protein-coupled receptor 44 |
UniProt ID | Q6XKD3 |
◆ Recombinant Proteins | ||
PTGDR2-932H | Recombinant Human PTGDR2 Full Length Transmembrane protein(Nanodisc) | +Inquiry |
RFL26992RF | Recombinant Full Length Rat Prostaglandin D2 Receptor 2(Ptgdr2) Protein, His-Tagged | +Inquiry |
PTGDR2-2812H | Recombinant Human PTGDR2 Protein, His-tagged, OVA Conjugated | +Inquiry |
PTGDR2-1135HFL | Recombinant Human PTGDR2 protein, His&Flag-tagged | +Inquiry |
PTGDR2-4803R | Recombinant Rat PTGDR2 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Ptgdr2 Products
Required fields are marked with *
My Review for All Ptgdr2 Products
Required fields are marked with *
0
Inquiry Basket