Recombinant Full Length Rat Secretin Receptor(Sctr) Protein, His-Tagged
Cat.No. : | RFL17850RF |
Product Overview : | Recombinant Full Length Rat Secretin receptor(Sctr) Protein (P23811) (26-449aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (26-449) |
Form : | Lyophilized powder |
AA Sequence : | VGVPPRLCDVRRVLLEERAHCLQQLSKEKKGALGPETASGCEGLWDNMSCWPSSAPARTV EVQCPKFLLMLSNKNGSLFRNCTQDGWSETFPRPDLACGVNINNSFNERRHAYLLKLKVM YTVGYSSSLAMLLVALSILCSFRRLHCTRNYIHMHLFVSFILRALSNFIKDAVLFSSDDV TYCDAHKVGCKLVMIFFQYCIMANYAWLLVEGLYLHTLLAISFFSERKYLQAFVLLGWGS PAIFVALWAITRHFLENTGCWDINANASVWWVIRGPVILSILINFIFFINILRILMRKLR TQETRGSETNHYKRLAKSTLLLIPLFGIHYIVFAFSPEDAMEVQLFFELALGSFQGLVVA VLYCFLNGEVQLEVQKKWRQWHLQEFPLRPVAFNNSFSNATNGPTHSTKASTEQSRSIPR ASII |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Sctr |
Synonyms | Sctr; Secretin receptor; SCT-R |
UniProt ID | P23811 |
◆ Recombinant Proteins | ||
SCTR-1109HFL | Recombinant Human SCTR protein, His&Flag-tagged | +Inquiry |
SCTR-4051C | Recombinant Chicken SCTR | +Inquiry |
SCTR-4940R | Recombinant Rat SCTR Protein, His (Fc)-Avi-tagged | +Inquiry |
SCTR-8178Z | Recombinant Zebrafish SCTR | +Inquiry |
RFL8498HF | Recombinant Full Length Human Secretin Receptor(Sctr) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCTR-1573HCL | Recombinant Human SCTR cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Sctr Products
Required fields are marked with *
My Review for All Sctr Products
Required fields are marked with *
0
Inquiry Basket