Recombinant Full Length Rat T-Cell Surface Glycoprotein Cd8 Alpha Chain(Cd8A) Protein, His-Tagged
| Cat.No. : | RFL27560RF |
| Product Overview : | Recombinant Full Length Rat T-cell surface glycoprotein CD8 alpha chain(Cd8a) Protein (P07725) (27-236aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length of Mature Protein (27-236) |
| Form : | Lyophilized powder |
| AA Sequence : | QLQLSPKKVDAEIGQEVKLTCEVLRDTSQGCSWLFRNSSSELLQPTFIIYVSSSRSKLNDILDPNLFSARKENNKYILTLSKFSTKNQGYYFCSITSNSVMYFSPLVPVFQKVNSIITKPVTRAPTPVPPPTGTPRPLRPEACRPGASGSVEGMGLGFACDIYIWAPLAGICAVLLLSLVITLICCHRNRRRVCKCPRPLVKPRPSEKFV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Cd8a |
| Synonyms | Cd8a; T-cell surface glycoprotein CD8 alpha chain; CD8 antigen 32 kDa chain; OX-8 membrane antigen; CD antigen CD8a |
| UniProt ID | P07725 |
| ◆ Recombinant Proteins | ||
| CD8A-568H | Active Recombinant Cynomolgus CD8A protein, His-tagged | +Inquiry |
| CD8A-3090HF | Recombinant Full Length Human CD8A Protein, GST-tagged | +Inquiry |
| CD8A-274H | Recombinant Human CD8A protein, His-tagged | +Inquiry |
| CD8A-1461H | Recombinant Human CD8A Protein (Ser22-Asp182), N-His tagged | +Inquiry |
| CD8A-273H | Recombinant Human CD8A protein, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CD8A-2514MCL | Recombinant Mouse CD8A cell lysate | +Inquiry |
| CD8A-827RCL | Recombinant Rat CD8A cell lysate | +Inquiry |
| CD8A-1872FCL | Recombinant Ferret CD8A cell lysate | +Inquiry |
| CD8A-2493HCL | Recombinant Human CD8A cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Cd8a Products
Required fields are marked with *
My Review for All Cd8a Products
Required fields are marked with *
