Recombinant Full Length Rat Taste Receptor Type 2 Member 107(Tas2R107) Protein, His-Tagged
Cat.No. : | RFL2929RF |
Product Overview : | Recombinant Full Length Rat Taste receptor type 2 member 107(Tas2r107) Protein (Q9JKT9) (1-308aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-308) |
Form : | Lyophilized powder |
AA Sequence : | MLSAAEGILLCVVTSEAVLGVLGDTFIALANCMEYAKNKKLSKIGFILIGLAISRIGVVW IIILQGYMQVFFPHILTFGNITEYITYIWVFLNHLSVWFATNLNILYFLKIANFSNSVFL WLKSRVRVVFIFLSGCLLTSWLLCFPQFSKMLNNSKMYWGNTSWLQQQKNVFLINQSLTN LGIFFFIIVSLITCFLLIVFLWRHIRQMHSDGSGLRDLNTEAHVKAMRVLISFAVLFILH FVGLSIQVLCFFLPQNNLLFITGLIATCLYPCGHSIILILGNKQLKQASLKALQHLTCCE TKRNLSVT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tas2r107 |
Synonyms | Tas2r107; Tas2r10; Tas2r4; Taste receptor type 2 member 107; T2R107; Taste receptor type 2 member 4; T2R4 |
UniProt ID | Q9JKT9 |
◆ Recombinant Proteins | ||
RFL2929RF | Recombinant Full Length Rat Taste Receptor Type 2 Member 107(Tas2R107) Protein, His-Tagged | +Inquiry |
TAS2R107-8997M | Recombinant Mouse TAS2R107 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL14237MF | Recombinant Full Length Mouse Taste Receptor Type 2 Member 107(Tas2R107) Protein, His-Tagged | +Inquiry |
TAS2R107-5938R | Recombinant Rat TAS2R107 Protein | +Inquiry |
TAS2R107-5597R | Recombinant Rat TAS2R107 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tas2r107 Products
Required fields are marked with *
My Review for All Tas2r107 Products
Required fields are marked with *
0
Inquiry Basket