Recombinant Full Length Rat Taste Receptor Type 2 Member 134(Tas2R134) Protein, His-Tagged
Cat.No. : | RFL26048RF |
Product Overview : | Recombinant Full Length Rat Taste receptor type 2 member 134(Tas2r134) Protein (Q67ES7) (1-329aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-329) |
Form : | Lyophilized powder |
AA Sequence : | MRCSLRGCVQGRGGKSGVSLSKFSPKKMSFFFIFMVIFCIQSLVALLQNGFLATVLGREW VRSQGLPAGDMIVACLAASRFCLHGVAIVNNFLTFVKLWSQKIYFSVLWDFVNTVNFWCT TWLAIFYCVKISSFSHPIFFWIKWRISRSVPRLLLGSLVIGGLSAVSSATGNTIAFQMTA CENYTLAYRTRAFYAYYFRCHAMLMWIIPFFLFLLSVILLMFSLYRHLEHMRYRRPWSHD YSTQAHTMALKSLAFFLVFYTSYVLFLVISVTRVVNVHSSWHWAWEVITYMGILLHSTIL TLSNPKMRKALKIKFPDLCVARSQDKRRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tas2r134 |
Synonyms | Tas2r134; Tas2r23; Tas2r34; Taste receptor type 2 member 134; T2R134; T2R34; Taste receptor type 2 member 23; T2R23 |
UniProt ID | Q67ES7 |
◆ Recombinant Proteins | ||
RFL26048RF | Recombinant Full Length Rat Taste Receptor Type 2 Member 134(Tas2R134) Protein, His-Tagged | +Inquiry |
RFL25835MF | Recombinant Full Length Mouse Taste Receptor Type 2 Member 134(Tas2R134) Protein, His-Tagged | +Inquiry |
TAS2R134-16459M | Recombinant Mouse TAS2R134 Protein | +Inquiry |
TAS2R134-9014M | Recombinant Mouse TAS2R134 Protein, His (Fc)-Avi-tagged | +Inquiry |
TAS2R134-5613R | Recombinant Rat TAS2R134 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tas2r134 Products
Required fields are marked with *
My Review for All Tas2r134 Products
Required fields are marked with *
0
Inquiry Basket