Recombinant Full Length Rat Thromboxane A2 Receptor(Tbxa2R) Protein, His-Tagged
Cat.No. : | RFL18678RF |
Product Overview : | Recombinant Full Length Rat Thromboxane A2 receptor(Tbxa2r) Protein (P34978) (1-341aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-341) |
Form : | Lyophilized powder |
AA Sequence : | MWLNSTSLGACFRPVNITLQERRAIASPWFAASFCALGLGSNLLALSVLAGARPGAGPRS SFLALLCGLVLTDFLGLLVTGAVVASQHAALLDWRATDPGCRLCHFMGAAMVFFGLCPLL LGAAMAAERFVGITRPFSRPAATSRRAWATVGLVWVGAGTLGLLPLLGLGRYSVQYPGSW CFLTLGAERGDVAFGLMFALLGSVSVGLSLLLNTVSVATLCRVYHAREATQRPRDCEVEM MVQLVGIMVVATVCWMPLLVFILQTLLQTLPVMSPSGQLLRTTERQLLIYLRVATWNQIL DPWVYILFRRSVLRRLHPRFTSQLQAVSLHSPPTQAMLSGP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tbxa2r |
Synonyms | Tbxa2r; Thromboxane A2 receptor; TXA2-R; Prostanoid TP receptor; TXR2 |
UniProt ID | P34978 |
◆ Recombinant Proteins | ||
TBXA2R-16536M | Recombinant Mouse TBXA2R Protein | +Inquiry |
TBXA2R-8384Z | Recombinant Zebrafish TBXA2R | +Inquiry |
RFL24034CF | Recombinant Full Length Chlorocebus Aethiops Thromboxane A2 Receptor(Tbxa2R) Protein, His-Tagged | +Inquiry |
TBXA2R-6403H | Recombinant Human TBXA2R Protein (Pro3-Ser324), N-His tagged | +Inquiry |
RFL18678RF | Recombinant Full Length Rat Thromboxane A2 Receptor(Tbxa2R) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
TBXA2R-1197HCL | Recombinant Human TBXA2R 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Tbxa2r Products
Required fields are marked with *
My Review for All Tbxa2r Products
Required fields are marked with *
0
Inquiry Basket