Recombinant Full Length Rat Transmembrane Protein Adipocyte-Associated 1(Tpra1) Protein, His-Tagged
| Cat.No. : | RFL2059RF |
| Product Overview : | Recombinant Full Length Rat Transmembrane protein adipocyte-associated 1(Tpra1) Protein (Q791F6) (1-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Rat |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-369) |
| Form : | Lyophilized powder |
| AA Sequence : | MASLQEANGSTAWPPPTASNISEPHQCLLLLYEDIGSSRVRYWDLLLLIPNVLFFIFLLW KLPLARAKIRVTSSPIFITFYILVFVVALVGIARAVVSMTVSASDAATVADKILWEITRF FLLAIELSVIILGLAFGHLESKSSIKRVLAITTVLSLAYSVTQGTLEILYPDSHLSAEDF NIYGHGGRQFWLVSSCFFFLVYSLVVILPKTPLKERVSLPSRRSFYVYAGILATLNLLQG LGSALLCANIIVGLCCVDATTFLYFSFFAPLIYVAFLRGFFGSEPKILFSYKCQVDEAEE PDMHLPQPYAVARREGIESAGPACASAANYSSTQFDSAGVAYLDDIASMPCHTGSINSTD SERWKAINA |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | Tpra1 |
| Synonyms | Tpra1; Gpr175; Tpra40; Transmembrane protein adipocyte-associated 1; Integral membrane protein GPR175; TPRA40; Transmembrane domain protein of 40 kDa regulated in adipocytes |
| UniProt ID | Q791F6 |
| ◆ Recombinant Proteins | ||
| TPRA1-17267M | Recombinant Mouse TPRA1 Protein | +Inquiry |
| TPRA1-5216H | Recombinant Human TPRA1 Protein, GST-tagged | +Inquiry |
| TPRA1-9546M | Recombinant Mouse TPRA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| TPRA1-4923R | Recombinant Rhesus monkey TPRA1 Protein, His-tagged | +Inquiry |
| RFL2059RF | Recombinant Full Length Rat Transmembrane Protein Adipocyte-Associated 1(Tpra1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| TPRA1-743HCL | Recombinant Human TPRA1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tpra1 Products
Required fields are marked with *
My Review for All Tpra1 Products
Required fields are marked with *
