Recombinant Full Length Rat Tumor Suppressor Candidate 5 Homolog(Tusc5) Protein, His-Tagged
Cat.No. : | RFL5803RF |
Product Overview : | Recombinant Full Length Rat Tumor suppressor candidate 5 homolog(Tusc5) Protein (Q2MHH0) (1-173aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-173) |
Form : | Lyophilized powder |
AA Sequence : | MANPVQPQLQDPGSTSPLDLPEMEKLLTKVENKDDQALNLSKSLSGALDLEQNGHSLPFK VISEGHRQPSLSGSPSRASSRRASSVVTTSYAQDQEAPKDYLVLAIASCFCPVWPLNLIP LIFSIMSRSSVQQGDLDGARRLGRLARLLSITFIILGIVIIIVAVTVNFTVPK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Tusc5 |
Synonyms | Trarg1; Tusc5; Trafficking regulator of GLUT4 1; Brain endothelial cell-derived protein 1; BEC-1; Dispanin subfamily B member 1; DSPB1; Tumor suppressor candidate 5 homolog |
UniProt ID | Q2MHH0 |
◆ Recombinant Proteins | ||
TUSC5-2880H | Recombinant Human TUSC5 Protein, MYC/DDK-tagged | +Inquiry |
RFL32635XF | Recombinant Full Length Xenopus Tropicalis Tumor Suppressor Candidate 5 Homolog(Tusc5) Protein, His-Tagged | +Inquiry |
TUSC5-3491H | Recombinant Human TUSC5, His-tagged | +Inquiry |
RFL5803RF | Recombinant Full Length Rat Tumor Suppressor Candidate 5 Homolog(Tusc5) Protein, His-Tagged | +Inquiry |
TUSC5-17640M | Recombinant Mouse TUSC5 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Tusc5 Products
Required fields are marked with *
My Review for All Tusc5 Products
Required fields are marked with *