Recombinant Full Length Rat Vesicle-Associated Membrane Protein 3(Vamp3) Protein, His-Tagged
Cat.No. : | RFL33250RF |
Product Overview : | Recombinant Full Length Rat Vesicle-associated membrane protein 3(Vamp3) Protein (P63025) (1-103aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-103) |
Form : | Lyophilized powder |
AA Sequence : | MSTGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCKMWAIGISVLVIIVIIIIVWCVS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Vamp3 |
Synonyms | Vamp3; Syb3; Vesicle-associated membrane protein 3; VAMP-3; Cellubrevin; CEB; Synaptobrevin-3 |
UniProt ID | P63025 |
◆ Recombinant Proteins | ||
VAMP3-5142R | Recombinant Rhesus monkey VAMP3 Protein, His-tagged | +Inquiry |
VAMP3-369H | Recombinant Human VAMP3, His tagged | +Inquiry |
VAMP3-3389C | Recombinant Chicken VAMP3 | +Inquiry |
VAMP3-27011TH | Recombinant Human VAMP3 | +Inquiry |
VAMP3-1070H | Recombinant Human VAMP3 protein(Met1-Lys77), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
VAMP3-437HCL | Recombinant Human VAMP3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Vamp3 Products
Required fields are marked with *
My Review for All Vamp3 Products
Required fields are marked with *