Recombinant Full Length Rat Voltage-Dependent Calcium Channel Gamma-5 Subunit(Cacng5) Protein, His-Tagged
Cat.No. : | RFL23343RF |
Product Overview : | Recombinant Full Length Rat Voltage-dependent calcium channel gamma-5 subunit(Cacng5) Protein (Q8VHW8) (1-275aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-275) |
Form : | Lyophilized powder |
AA Sequence : | MSTCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGIILPQNQSTEVKMSLHSGLWR VCFLAGEERGRCFTIEYVMPMNSQMTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTKDAETYFNYKYGWSFA FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWIRG RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cacng5 |
Synonyms | Cacng5; Voltage-dependent calcium channel gamma-5 subunit; Neuronal voltage-gated calcium channel gamma-5 subunit; Transmembrane AMPAR regulatory protein gamma-5; TARP gamma-5 |
UniProt ID | Q8VHW8 |
◆ Recombinant Proteins | ||
CACNG5-5459H | Recombinant Human CACNG5 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
CACNG5-3024HF | Recombinant Full Length Human CACNG5 Protein, GST-tagged | +Inquiry |
RFL15765HF | Recombinant Full Length Human Voltage-Dependent Calcium Channel Gamma-5 Subunit(Cacng5) Protein, His-Tagged | +Inquiry |
CACNG5-738R | Recombinant Rat CACNG5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CACNG5-0277H | Recombinant Human CACNG5 Protein, GST-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cacng5 Products
Required fields are marked with *
My Review for All Cacng5 Products
Required fields are marked with *
0
Inquiry Basket