Recombinant Full Length Rat Zinc Transporter 4(Slc30A4) Protein, His-Tagged
Cat.No. : | RFL2708RF |
Product Overview : | Recombinant Full Length Rat Zinc transporter 4(Slc30a4) Protein (O55174) (1-430aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-430) |
Form : | Lyophilized powder |
AA Sequence : | MAGPGAWKRLKSLLRKDDAPLFLNDTSAFDFLDEVSDEGLSRFNKLRVVVADDDSEAPER PVNGAHPALQADDDSLLDQELPLTNSQLSLKMDPCDNCSKRRELLKQRKVKTRLTIAAVL YLLFMIGELVGGYMANSLAIMTDALHMLTDLSAIILTLLALWLSSKSPTRRFTFGFHRLE VLSAMISVMLVYVLMGFLLYEAMQRTIHMNYEINGDVMLITAAVGVAVNVIMGFLLNQSG HHHSHAHSHSLPSNSPSMVSSGHSHGQDSLAVRAAFVHALGDLVQSVGVLIAAYIIRFKP EYKIADPICTYIFSLLVAFTTLRIIWDTVVIILEGVPSHLNVDYIKESLMKIEDVYSVED LNIWSLTSGKATAIVHMQLIPGSSSKWEEVQSKAKHLLLNTFGMYKCTVQLQSYRQEATR TCANCQSSST |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Slc30a4 |
Synonyms | Slc30a4; Znt4; Zinc transporter 4; ZnT-4; Dri 27 protein; Solute carrier family 30 member 4 |
UniProt ID | O55174 |
◆ Recombinant Proteins | ||
RFL637MF | Recombinant Full Length Mouse Zinc Transporter 4(Slc30A4) Protein, His-Tagged | +Inquiry |
SLC30A4-5163R | Recombinant Rat SLC30A4 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC30A4-15375M | Recombinant Mouse SLC30A4 Protein | +Inquiry |
SLC30A4-2749H | Recombinant Human SLC30A4, GST-tagged | +Inquiry |
RFL2905HF | Recombinant Full Length Human Zinc Transporter 4(Slc30A4) Protein, His-Tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All Slc30a4 Products
Required fields are marked with *
My Review for All Slc30a4 Products
Required fields are marked with *
0
Inquiry Basket