Recombinant Full Length Saimiri Sciureus Cytochrome C Oxidase Subunit 6C(Cox6C) Protein, His-Tagged
Cat.No. : | RFL13798SF |
Product Overview : | Recombinant Full Length Saimiri sciureus Cytochrome c oxidase subunit 6C(COX6C) Protein (Q7YRJ9) (2-75aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Saimiri sciureus (Common squirrel monkey) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-75) |
Form : | Lyophilized powder |
AA Sequence : | ASEVLAKPQMRGLLARRLRIHMVGAFLISLGVAALYKFGVAEPRKKAYADFYKNYSPEKD FEEMKKAGVFRSIK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | COX6C |
Synonyms | COX6C; Cytochrome c oxidase subunit 6C; Cytochrome c oxidase polypeptide VIc |
UniProt ID | Q7YRJ9 |
◆ Recombinant Proteins | ||
RFL13798SF | Recombinant Full Length Saimiri Sciureus Cytochrome C Oxidase Subunit 6C(Cox6C) Protein, His-Tagged | +Inquiry |
COX6C-1758H | Recombinant Human COX6C Protein, GST-tagged | +Inquiry |
COX6C-11498H | Recombinant Human COX6C, GST-tagged | +Inquiry |
COX6C-1556R | Recombinant Rat COX6C Protein | +Inquiry |
Cox6c-622M | Recombinant Mouse Cox6c Protein, His/GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX6C-7327HCL | Recombinant Human COX6C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX6C Products
Required fields are marked with *
My Review for All COX6C Products
Required fields are marked with *