Recombinant Full Length Schizosaccharomyces Pombe Reticulon-Like Protein 1(Rtn1) Protein, His-Tagged
Cat.No. : | RFL25420SF |
Product Overview : | Recombinant Full Length Schizosaccharomyces pombe Reticulon-like protein 1(rtn1) Protein (P53694) (1-308aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Schizosaccharomyces pombe |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-308) |
Form : | Lyophilized powder |
AA Sequence : | MSEQHSLNPFESGSVTASDVAAAKSGAEDLVNTLTAHTVHPSTELPSATSFPSALPNSEN PVIQNISSSSSEPHHTSQSTPGETSSPVCPVSGAHGGADKKCPALEAGCPFTNTTKQNVD PEISNALWSVLTWKNTSCSFSTLMSILALVYVPSWINLPRLFFRTFRYVFLITSIIEFGG LFASNGKRGVLSHFRSSYITCDSKALDRIVNSIVDIFNVMLIQFQRILFAESPILTFTAS VAAFIEFFLSGFLSYKSLFVWNVLFAFILPRLYVCNERSIKHLVASLERSGDKLKKQATE TINTTVNK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | rtn1 |
Synonyms | rtn1; cwl1; SPBC31A8.01c; SPBC651.13c; Reticulon-like protein 1; Cell lysis protein cwl1 |
UniProt ID | P53694 |
◆ Recombinant Proteins | ||
RTN1-157H | Recombinant Human RTN1 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
RTN1-2462H | Recombinant Human RTN1, GST-tagged | +Inquiry |
RTN1-891HFL | Recombinant Full Length Human RTN1 Protein, C-Flag-tagged | +Inquiry |
RTN1-8151H | Recombinant Human RTN1 protein, His & GST-tagged | +Inquiry |
RTN1-1953H | Recombinant Human RTN1 Protein, MYC/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All rtn1 Products
Required fields are marked with *
My Review for All rtn1 Products
Required fields are marked with *
0
Inquiry Basket