Recombinant Full Length Sheep Corticosteroid 11-Beta-Dehydrogenase Isozyme 1(Hsd11B1) Protein, His-Tagged
Cat.No. : | RFL24163OF |
Product Overview : | Recombinant Full Length Sheep Corticosteroid 11-beta-dehydrogenase isozyme 1(HSD11B1) Protein (P51975) (2-292aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-292) |
Form : | Lyophilized powder |
AA Sequence : | AFMKKYLLPILGIFLAYYYYSANEEFRPEMLRGKRVIVTGASKGIGREMAYHLARMGAHVVVTARSEESLKKVVSRCLELGAASAHYVAGTMENMTFAEQFVAKAGELVGGLDMLILNHINYTPLRVFSNDIHLLRRSLEVNLLSYVVLSTAALPMLKQTSGSIVVVSSVAGKIACPLAAAYSASKFALDGFFSSLRTEYEATKVNVSITLCILGLIDTDTAMKAVAGIYNAEASPKEECALEIIKGGALRQDEVYYDNSILTSLLLKNPGRKIMEFLSLKKYNMERFINN |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HSD11B1 |
Synonyms | HSD11B1; Corticosteroid 11-beta-dehydrogenase isozyme 1; 11-beta-hydroxysteroid dehydrogenase 1; 11-DH; 11-beta-HSD1 |
UniProt ID | P51975 |
◆ Recombinant Proteins | ||
HSD11B1-065H | Active Recombinant Human HSD11B1 Protein, His-tagged | +Inquiry |
Hsd11b1-1175M | Recombinant Mouse Hsd11b1 Protein, MYC/DDK-tagged | +Inquiry |
Hsd11b1-1636M | Recombinant Mouse Hsd11b1 Protein, His-tagged | +Inquiry |
HSD11B1-1415H | Recombinant Human HSD11B1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
HSD11B1-1099H | Recombinant Human HSD11B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HSD11B1-5381HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
HSD11B1-5380HCL | Recombinant Human HSD11B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HSD11B1 Products
Required fields are marked with *
My Review for All HSD11B1 Products
Required fields are marked with *