Recombinant Full Length Sheep Melatonin Receptor Type 1A(Mtnr1A) Protein, His-Tagged
Cat.No. : | RFL25648OF |
Product Overview : | Recombinant Full Length Sheep Melatonin receptor type 1A(MTNR1A) Protein (P48040) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sheep |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MAGRLWGSPGGTPKGNGSSALLNVSQAAPGAGDGVRPRPSWLAATLASILIFTIVVDIVG NLLVVLSVYRNKKLRNAGNVFVVSLAVADLLVAVYPYPLALASIVNNGWSLSSLHCQLSG FLMGLSVIGSVFSITGIAINRYCCICHSLRYGKLYSGTNSLCYVFLIWTLTLVAIVPNLC VGTLQYDPRIYSCTFTQSVSSAYTIAVVVFHFIVPMLVVVFCYLRIWALVLQVRWKVKPD NKPKLKPQDFRNFVTMFVVFVLFAICWAPLNFIGLVVASDPASMAPRIPEWLFVASYYMA YFNSCLNAIIYGLLNQNFRQEYRKIIVSLCTTKMFFVDSSNHVADRIKRKPSPLIANHNL IKVDSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | MTNR1A |
Synonyms | MTNR1A; Melatonin receptor type 1A; Mel-1A-R; Mel1a receptor |
UniProt ID | P48040 |
◆ Recombinant Proteins | ||
MTNR1A-301234H | Recombinant Human MTNR1A protein, GST-tagged | +Inquiry |
MTNR1A-1482HFL | Recombinant Full Length Human MTNR1A Protein, C-Flag-tagged | +Inquiry |
RFL25648OF | Recombinant Full Length Sheep Melatonin Receptor Type 1A(Mtnr1A) Protein, His-Tagged | +Inquiry |
MTNR1A-8163G | Recombinant Goat MTNR1A protein, His & S-tagged | +Inquiry |
RFL23708RF | Recombinant Full Length Rat Melatonin Receptor Type 1A(Mtnr1A) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MTNR1A-4071HCL | Recombinant Human MTNR1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MTNR1A Products
Required fields are marked with *
My Review for All MTNR1A Products
Required fields are marked with *
0
Inquiry Basket