Recombinant Full Length Synechocystis Sp. Probable Diacylglycerol Kinase(Dgka) Protein, His-Tagged
| Cat.No. : | RFL17595SF |
| Product Overview : | Recombinant Full Length Synechocystis sp. Probable diacylglycerol kinase(dgkA) Protein (Q55143) (1-175aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Synechococcus sp. |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-175) |
| Form : | Lyophilized powder |
| AA Sequence : | MKSVYPMSSPSSAVFADQGLSGKANQTQPPPPLGLVVPASKPGAKKPLRKNAWQVAPNLL VSFRYAWAGVSYAFATQRNFRIHTFTGVAVITAASLLHLEAIAVAVLALTSCLVMILELL NTALESVVDLTVGQSYHELAKIAKDCAAGAVLLAAIAAVIVGGCLLLPPLLSLMV |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | dgkA |
| Synonyms | dgkA; slr0054; Diacylglycerol kinase; DAGK; Diglyceride kinase; DGK |
| UniProt ID | Q55143 |
| ◆ Recombinant Proteins | ||
| DGKA-627HFL | Recombinant Full Length Human DGKA Protein, C-Flag-tagged | +Inquiry |
| DGKA-358H | Recombinant Human DGKA Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
| DGKA-1512R | Recombinant Rat DGKA Protein, His (Fc)-Avi-tagged | +Inquiry |
| DGKA-1854R | Recombinant Rat DGKA Protein | +Inquiry |
| RFL4857BF | Recombinant Full Length Bacillus Subtilis Undecaprenol Kinase(Dgka) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| DGKA-6960HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
| DGKA-6961HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All dgkA Products
Required fields are marked with *
My Review for All dgkA Products
Required fields are marked with *
