Recombinant Human DGKA Protein (1-735 aa), His-tagged
Cat.No. : | DGKA-2096H |
Product Overview : | Recombinant Human DGKA Protein (1-735 aa) is produced by E. coli expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Signal Transduction. Protein Description: Full Length. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-735 aa |
Description : | Upon cell stimulation converts the second messenger diacylglycerol into phosphatidate, initiating the resynthesis of phosphatidylinositols and attenuating protein kinase C activity. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 86.6 kDa |
AA Sequence : | MAKERGLISPSDFAQLQKYMEYSTKKVSDVLKLFEDGEMAKYVQGDAIGYEGFQQFLKIYLEVDNVPRHLSLALFQSFETGHCLNETNVTKDVVCLNDVSCYFSLLEGGRPEDKLEFTFKLYDTDRNGILDSSEVDKIILQMMRVAEYLDWDVSELRPILQEMMKEIDYDGSGSVSQAEWVRAGATTVPLLVLLGLEMTLKDDGQHMWRPKRFPRPVYCNLCESSIGLGKQGLSCNLCKYTVHDQCAMKALPCEVSTYAKSRKDIGVQSHVWVRGGCESGRCDRCQKKIRIYHSLTGLHCVWCHLEIHDDCLQAVGHECDCGLLRDHILPPSSIYPSVLASGPDRKNSKTSQKTMDDLNLSTSEALRIDPVPNTHPLLVFVNPKSGGKQGQRVLWKFQYILNPRQVFNLLKDGPEIGLRLFKDVPDSRILVCGGDGTVGWILETIDKANLPVLPPVAVLPLGTGNDLARCLRWGGGYEGQNLAKILKDLEMSKVVHMDRWSVEVIPQQTEEKSDPVPFQIINNYFSIGVDASIAHRFHIMREKYPEKFNSRMKNKLWYFEFATSESIFSTCKKLEESLTVEICGKPLDLSNLSLEGIAVLNIPSMHGGSNLWGDTRRPHGDIYGINQALGATAKVITDPDILKTCVPDLSDKRLEVVGLEGAIEMGQIYTKLKNAGRRLAKCSEITFHTTKTLPMQIDGEPWMQTPCTIKITHKNQMPMLMGPPPRSTNFFGFLS |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
Gene Name | DGKA diacylglycerol kinase, alpha 80kDa [ Homo sapiens ] |
Official Symbol | DGKA |
Synonyms | DGKA; DGK alpha; DAG kinase alpha; DAGK; DAGK1; DGK-alpha; MGC12821; MGC42356; |
Gene ID | 1606 |
mRNA Refseq | NM_001345 |
Protein Refseq | NP_001336 |
MIM | 125855 |
UniProt ID | P23743 |
◆ Recombinant Proteins | ||
DGKA-2349M | Recombinant Mouse DGKA Protein, His (Fc)-Avi-tagged | +Inquiry |
Dgka-11R | Recombinant Active Rat Dgka Protein, His-tagged | +Inquiry |
Dgka-678R | Recombinant Rat Dgka Protein, His-tagged | +Inquiry |
Dgka-2534M | Recombinant Mouse Dgka Protein, Myc/DDK-tagged | +Inquiry |
RFL31584PF | Recombinant Full Length Pseudomonas Aeruginosa Diacylglycerol Kinase(Dgka) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
DGKA-6960HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
DGKA-6961HCL | Recombinant Human DGKA 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All DGKA Products
Required fields are marked with *
My Review for All DGKA Products
Required fields are marked with *
0
Inquiry Basket