Recombinant Full Length Torpedo Californica Sodium/Potassium-Transporting Atpase Subunit Beta-1(Atp1B1) Protein, His-Tagged
| Cat.No. : | RFL-19609TF |
| Product Overview : | Recombinant Full Length Torpedo californica Sodium/potassium-transporting ATPase subunit beta-1(atp1b1) Protein (P05029) (1-305aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Tetronarce Californica |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | Full Length (1-305) |
| Form : | Lyophilized powder |
| AA Sequence : | MAREKSTDDGGGWKKFLWDSEKKQVLGRTGTSWFKIFVFYLIFYGCLAGIFIGTIQVMLLTISDFEPKYQDRVAPPGLSHSPYAVKTEISFSVSNPNSYENHVNGLKELLKNYNESKQDGNTPFEDCGVIPADYITRGPIEESQGQKRVCRFLLQWLKNCSGIDDPSYGYSEGKPCIIAKLNRILGFYPKPPKNGTDLPEALQANYNQYVLPIHCQAKKEEDKVRIGTIEYFGMGGVGGFPLQYYPYYGKRLQKNYLQPLVGIQFTNLTHNVELRVECKVFGDNIAYSEKDRSLGRFEVKIEVKS |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Applications : | SDS-PAGE |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
| Gene Name | atp1b1 |
| Synonyms | atp1b1; Sodium/potassium-transporting ATPase subunit beta-1; Sodium/potassium-dependent ATPase subunit beta-1 |
| UniProt ID | P05029 |
| ◆ Recombinant Proteins | ||
| ATP1B1-246H | Recombinant Human ATP1B1, His tagged | +Inquiry |
| RFL-1006MF | Recombinant Full Length Mouse Sodium/Potassium-Transporting Atpase Subunit Beta-1(Atp1B1) Protein, His-Tagged | +Inquiry |
| ATP1B1-2279H | Recombinant Human ATP1B1 protein, His-tagged | +Inquiry |
| ATP1B1-321C | Recombinant Cynomolgus ATP1B1 Protein, His-tagged | +Inquiry |
| ATP1B1-856R | Recombinant Rat ATP1B1 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ATP1B1-919HCL | Recombinant Human ATP1B1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All atp1b1 Products
Required fields are marked with *
My Review for All atp1b1 Products
Required fields are marked with *



