Recombinant Full Length Ustilago Maydis Pheromone Receptor 1(Pra1) Protein, His-Tagged

Cat.No. : RFL9630UF
Product Overview : Recombinant Full Length Ustilago maydis Pheromone receptor 1(PRA1) Protein (P31302) (1-357aa), fused to N-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Ustilago maydis
Source : E.coli
Tag : His
Protein Length : Full Length (1-357)
Form : Lyophilized powder
AA Sequence : MLDHITPFFALVAFFLVLMPFAWHIKSKNVGLIMLSIWLMLGNLDNFVNSMVWWKTTADL APAYCELSVRLRHLLFIAIPASNLAIARKLESIASTRQVRAGPGDHRRAVIIDLLICLGI PIIYTSLMIVNQSNRYGILEEAGCWPMMVFSWLWVLLVAAPVIVVSLCSAVYSALAFRWF WVRRRQFQAVLASSASTINRSHYVRLLLLTAIDMLLFFPIYVGTIAAQIKSSISIPYGSW SSVHTGFNQIPQYPASLVLMENTFQRNLILARLVCPLSAYIFFAMFGLGLEVRQGYKEAF HRALLFCRLRKEPKASALQHVVADIEVVTFRSHDTFDANTSTKSEKSDIDMRGSEAA
Purity : Greater than 90% as determined by SDS-PAGE.
Applications : SDS-PAGE
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Storage : Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Storage Buffer : Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name PRA1
Synonyms PRA1; UMAG_02383; Pheromone receptor 1
UniProt ID P31302

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All PRA1 Products

Required fields are marked with *

My Review for All PRA1 Products

Required fields are marked with *

0
cart-icon