Recombinant Full Length Xenopus Laevis Hyaluronan Synthase 3(Has3) Protein, His-Tagged
Cat.No. : | RFL6230XF |
Product Overview : | Recombinant Full Length Xenopus laevis Hyaluronan synthase 3(has3) Protein (O57426) (1-190aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-190) |
Form : | Lyophilized powder |
AA Sequence : | SYFGCVQCISGPLGMYRNSLLQYFLEDWYHQTFLGQKCSFGDDRHLTNRVLSMGFRTKYT ARSRCLTETPTRYLRWLNQQTRWSKSYFREWLYNALWFHKHHLWMTYESVVTGFFPFFLV ATVVQLFYRGRVWNILLFLLTVQLVGILKATYACILRGNAEMIFMSLYSLLYMTSLLPAK IFAVITINKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | has3 |
Synonyms | has3; Hyaluronan synthase 3; Hyaluronate synthase 3; Hyaluronic acid synthase 3; HA synthase 3; xHAS3; Fragment |
UniProt ID | O57426 |
◆ Recombinant Proteins | ||
HAS3-4585H | Recombinant Human HAS3 Protein, GST-tagged | +Inquiry |
HAS3-1858R | Recombinant Rhesus Macaque HAS3 Protein, His (Fc)-Avi-tagged | +Inquiry |
HAS3-2037R | Recombinant Rhesus monkey HAS3 Protein, His-tagged | +Inquiry |
HAS3-9494Z | Recombinant Zebrafish HAS3 | +Inquiry |
HAS3-7487M | Recombinant Mouse HAS3 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
HAS3-5632HCL | Recombinant Human HAS3 293 Cell Lysate | +Inquiry |
HAS3-5633HCL | Recombinant Human HAS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All has3 Products
Required fields are marked with *
My Review for All has3 Products
Required fields are marked with *