Recombinant Full Length Human HAS3 Protein, GST-tagged
| Cat.No. : | HAS3-3484HF |
| Product Overview : | Human HAS3 full-length ORF ( AAH21853, 1 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 281 amino acids |
| Description : | The protein encoded by this gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS gene family. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq |
| Molecular Mass : | 56.65 kDa |
| AA Sequence : | MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | HAS3 hyaluronan synthase 3 [ Homo sapiens (human) ] |
| Official Symbol | HAS3 |
| Synonyms | HAS3; hyaluronan synthase 3; hyaluronan synthase 3; HA synthase 3; hyaluronate synthase 3; hyaluronic acid synthase 3; EC 2.4.1.212 |
| Gene ID | 3038 |
| mRNA Refseq | NM_001199280 |
| Protein Refseq | NP_001186209 |
| MIM | 602428 |
| UniProt ID | O00219 |
| ◆ Recombinant Proteins | ||
| RFL15311MF | Recombinant Full Length Mouse Hyaluronan Synthase 3(Has3) Protein, His-Tagged | +Inquiry |
| HAS3-4585H | Recombinant Human HAS3 Protein, GST-tagged | +Inquiry |
| HAS3-9494Z | Recombinant Zebrafish HAS3 | +Inquiry |
| HAS3-2037R | Recombinant Rhesus monkey HAS3 Protein, His-tagged | +Inquiry |
| RFL23560HF | Recombinant Full Length Human Hyaluronan Synthase 3(Has3) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| HAS3-5632HCL | Recombinant Human HAS3 293 Cell Lysate | +Inquiry |
| HAS3-5633HCL | Recombinant Human HAS3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All HAS3 Products
Required fields are marked with *
My Review for All HAS3 Products
Required fields are marked with *
