Recombinant Full Length Human HAS3 Protein, GST-tagged

Cat.No. : HAS3-3484HF
Product Overview : Human HAS3 full-length ORF ( AAH21853, 1 a.a. - 281 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 281 amino acids
Description : The protein encoded by this gene is involved in the synthesis of the unbranched glycosaminoglycan hyaluronan, or hyaluronic acid, which is a major constituent of the extracellular matrix. This gene is a member of the NODC/HAS gene family. Compared to the proteins encoded by other members of this gene family, this protein appears to be more of a regulator of hyaluronan synthesis. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq
Molecular Mass : 56.65 kDa
AA Sequence : MPVQLTTALRVVGTSLFALAVLGGILAAYVTGYQFIHTEKHYLSFGLYGAILGLHLLIQSLFAFLEHRRMRRAGQALKLPSPRRGSVALCIAAYQEDPDYLRKCLRSAQRISFPDLKVVMVVDGNRQEDAYMLDIFHEVLGGTEQAGFFVWRSNFHEAGEGETEASLQEGMDRVRDVVRASTFSCIMQKWGGKREVMYTAFKALGDSVDYIQVCDSDTVLDPACTIEMLRVLEEDPQVGGVGGDVQPPGKGMAVEDDQVQAAQVRATEAWSVHQRHVSREQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name HAS3 hyaluronan synthase 3 [ Homo sapiens (human) ]
Official Symbol HAS3
Synonyms HAS3; hyaluronan synthase 3; hyaluronan synthase 3; HA synthase 3; hyaluronate synthase 3; hyaluronic acid synthase 3; EC 2.4.1.212
Gene ID 3038
mRNA Refseq NM_001199280
Protein Refseq NP_001186209
MIM 602428
UniProt ID O00219

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All HAS3 Products

Required fields are marked with *

My Review for All HAS3 Products

Required fields are marked with *

0
cart-icon
0
compare icon