Recombinant Full Length Xenopus Laevis Marvel Domain-Containing Protein 1(Marveld1) Protein, His-Tagged
Cat.No. : | RFL8214XF |
Product Overview : | Recombinant Full Length Xenopus laevis MARVEL domain-containing protein 1(marveld1) Protein (Q6GPN9) (1-170aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-170) |
Form : | Lyophilized powder |
AA Sequence : | MEGERPRSDTVTTTVSSHMETISLGGSIAYDRSFLRSPTGVLLLMEIMFGLLVWALIAGS EYFLFSAFGWVMFVAVFYWVLSVFFFLLHLTRANTRITKVPWSLVGLCFNGSAFVLYLIA AVVEASSVNKDVHQHHNYNSWTASSFFAFIVTVCYALSTYFSFQAWRTKS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | marveld1 |
Synonyms | marveld1; MARVEL domain-containing protein 1 |
UniProt ID | Q6GPN9 |
◆ Recombinant Proteins | ||
RFL3719DF | Recombinant Full Length Danio Rerio Marvel Domain-Containing Protein 1(Marveld1) Protein, His-Tagged | +Inquiry |
Marveld1-3964M | Recombinant Mouse Marveld1 Protein, Myc/DDK-tagged | +Inquiry |
MARVELD1-5377M | Recombinant Mouse MARVELD1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL35608MF | Recombinant Full Length Mouse Marvel Domain-Containing Protein 1(Marveld1) Protein, His-Tagged | +Inquiry |
MARVELD1-9573M | Recombinant Mouse MARVELD1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MARVELD1-1062HCL | Recombinant Human MARVELD1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All marveld1 Products
Required fields are marked with *
My Review for All marveld1 Products
Required fields are marked with *