Recombinant Full Length Xenopus Laevis Peroxisomal Membrane Protein Pex16(Pex16) Protein, His-Tagged
Cat.No. : | RFL19414XF |
Product Overview : | Recombinant Full Length Xenopus laevis Peroxisomal membrane protein PEX16(pex16) Protein (Q6INN0) (1-340aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-340) |
Form : | Lyophilized powder |
AA Sequence : | MAARYWDKLRDLSQKYKEYVIQNPTGATQLESGVRMLSYLIAGRFADSHELSELVYSSSN LLALLNDGILRKELLTPPPTEGSRRRLLTWLGVLESLEVFIEIGAARAWGERSRWAAILI IQLLKACLRIVLLFWYRVGIQSSPPVTPLDREGILNQAEDNSKSSSSCFVGRRSSRAVRS LNDSASSHRRFWRSPQIHEGKQQKNGETENDKEGSELGTLGTLAEAIHILRPITHLLSLA ACGQKSWKPWMMAAALDITSISLLSDVRNLSRRERIELRRRMFLLLYYLLRSPFYNNYTE TRLLLLLRLLGDYVPGLGLVARPLMDYLPVWQKIYFYNWG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pex16 |
Synonyms | pex16; Peroxisomal membrane protein PEX16; Peroxin-16; Peroxisomal biogenesis factor 16 |
UniProt ID | Q6INN0 |
◆ Recombinant Proteins | ||
PEX16-12649M | Recombinant Mouse PEX16 Protein | +Inquiry |
Pex16-4797M | Recombinant Mouse Pex16 Protein, Myc/DDK-tagged | +Inquiry |
RFL27982XF | Recombinant Full Length Xenopus Tropicalis Peroxisomal Membrane Protein Pex16(Pex16) Protein, His-Tagged | +Inquiry |
RFL19414XF | Recombinant Full Length Xenopus Laevis Peroxisomal Membrane Protein Pex16(Pex16) Protein, His-Tagged | +Inquiry |
PEX16-3074Z | Recombinant Zebrafish PEX16 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PEX16-3290HCL | Recombinant Human PEX16 293 Cell Lysate | +Inquiry |
PEX16-3291HCL | Recombinant Human PEX16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All pex16 Products
Required fields are marked with *
My Review for All pex16 Products
Required fields are marked with *