Recombinant Full Length Xenopus Tropicalis Nedd4 Family-Interacting Protein 1(Ndfip1) Protein, His-Tagged
Cat.No. : | RFL15672XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis NEDD4 family-interacting protein 1(ndfip1) Protein (Q4V786) (1-211aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-211) |
Form : | Lyophilized powder |
AA Sequence : | MSEQSSSRYQQLQNEEEPGENPQASTDAPPPYSSIAGESSGLFDYKDELGFPKPPSYNVA TSLPSYDEAERTKAEATIPLVPGRDDDFVARDDFDDADQLRIGNDGIFMLTFFMAFLFNW IGFFLSFCLTSSAAGRYGAISGFGLSLIKWILIVRFSTYFPGYFDGQYWLWWVFLVLGFL LFLRGFINYAKVRKMPDNFSTLPRTRVLFIY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndfip1 |
Synonyms | ndfip1; NEDD4 family-interacting protein 1 |
UniProt ID | Q4V786 |
◆ Recombinant Proteins | ||
NDFIP1-10496M | Recombinant Mouse NDFIP1 Protein | +Inquiry |
NDFIP1-2965R | Recombinant Rhesus monkey NDFIP1 Protein, His-tagged | +Inquiry |
RFL32394MF | Recombinant Full Length Mouse Nedd4 Family-Interacting Protein 1(Ndfip1) Protein, His-Tagged | +Inquiry |
NDFIP1-10065Z | Recombinant Zebrafish NDFIP1 | +Inquiry |
RFL29755HF | Recombinant Full Length Human Nedd4 Family-Interacting Protein 1(Ndfip1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NDFIP1-3935HCL | Recombinant Human NDFIP1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ndfip1 Products
Required fields are marked with *
My Review for All ndfip1 Products
Required fields are marked with *