Recombinant Full Length Xenopus Tropicalis Organic Solute Transporter Subunit Alpha(Osta) Protein, His-Tagged
Cat.No. : | RFL25507XF |
Product Overview : | Recombinant Full Length Xenopus tropicalis Organic solute transporter subunit alpha(osta) Protein (A9ULC7) (1-339aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus tropicalis (Western clawed frog) (Silurana tropicalis) |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-339) |
Form : | Lyophilized powder |
AA Sequence : | MDPEQNDTKPPFNPICATRQAPYSHEILENLDITGILLFAILTFMTLVSLLVFLEEAYYM YRKIPNPKNSIIIWINAGAMMIATTSCFGMWIPRSTMFTDFTASVFLAVLIHKFQLMLVN ECGGRREFLSTFGDTKLKISTGPFCCCCLCLPHKDINRKTLFILKLGTFQFAFLRPVLMF LAVVLWTNGTYMIGNSSAEKATIWINIGVGITTITALWAVGIMFNLVKDNLKEKNIIGKF AVYQFTVILSQLQTSIINILGTTGVISCVPPLPGPSRASYMNQQLLIMEMFLVTVICRVL YRRRYDDKNLLENQETNDNLRNSMMHLNGKALEDGPQSV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | slc51a |
Synonyms | slc51a; osta; Organic solute transporter subunit alpha; OST-alpha; Solute carrier family 51 subunit alpha |
UniProt ID | A9ULC7 |
◆ Recombinant Proteins | ||
SLC51A-5070C | Recombinant Chicken SLC51A | +Inquiry |
RFL21271MF | Recombinant Full Length Mouse Organic Solute Transporter Subunit Alpha(Osta) Protein, His-Tagged | +Inquiry |
SLC51A-2698H | Recombinant Human SLC51A Protein, His-tagged | +Inquiry |
RFL23044DF | Recombinant Full Length Danio Rerio Organic Solute Transporter Subunit Alpha(Osta) Protein, His-Tagged | +Inquiry |
SLC51A-4078H | Recombinant Human SLC51A Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC51A-461HCL | Recombinant Human SLC51A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All slc51a Products
Required fields are marked with *
My Review for All slc51a Products
Required fields are marked with *