Recombinant Full Length Zea Mays Cell Number Regulator 1(Cnr1) Protein, His-Tagged
Cat.No. : | RFL2081ZF |
Product Overview : | Recombinant Full Length Zea mays Cell number regulator 1(CNR1) Protein (B6TZ45) (1-191aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Zea Mays |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-191) |
Form : | Lyophilized powder |
AA Sequence : | MYPSAPPDAYNKFSAGAPPTAPPPPAAYHQQQQQHGANMDTSRPGGGLRKWSTGLFHCMD DPGNCLITCLCPCVTFGQVADIVDKGTCPCIASGLVYGLICASTGMGCLYSCLYRSKLRA EYDLDEGECPDILVHCCCEHLALCQEYRELKNRGFDLGIGWEANMDRQRRGVAGGGAVMG APPAIPLGMIR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CNR1 |
Synonyms | CNR1; Cell number regulator 1; ZmCNR01 |
UniProt ID | B6TZ45 |
◆ Recombinant Proteins | ||
CNR1-3314C | Recombinant Chicken CNR1 | +Inquiry |
RFL32060FF | Recombinant Full Length Cat Cannabinoid Receptor 1(Cnr1) Protein, His-Tagged | +Inquiry |
RFL9726HF | Recombinant Full Length Human Cannabinoid Receptor 1(Cnr1) Protein, His-Tagged | +Inquiry |
CNR1-1958HF | Recombinant Full Length Human CNR1 Protein, GST-tagged | +Inquiry |
CNR1-1153HFL | Recombinant Human CNR1 protein, His&Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNR1-7395HCL | Recombinant Human CNR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNR1 Products
Required fields are marked with *
My Review for All CNR1 Products
Required fields are marked with *