Recombinant Glycine max Leghemoglobin C2, His&HA-tagged
Cat.No. : | C2-773G |
Product Overview : | Recombinant Glycine max Leghemoglobin C2(P02236)(2-145aa), fused with N-terminal His tag and C-terminal HA tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Glycine max |
Source : | E.coli |
Tag : | HA&His |
Protein Length : | 2-145aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 20.6 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | GAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF |
◆ Recombinant Proteins | ||
C2-1143M | Recombinant Mouse C2 Protein, His (Fc)-Avi-tagged | +Inquiry |
C2-1878C | Active Recombinant Cynomolgus C2 protein, His-tagged | +Inquiry |
C2-1032H | Active Recombinant Human C2 protein, His-tagged | +Inquiry |
C2-598H | Recombinant Human Complement Component 2, His-tagged | +Inquiry |
C2-1012M | Active Recombinant Mouse C2 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
C2-98H | Active Native Human C2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
C2-001MCL | Recombinant Mouse C2 cell lysate | +Inquiry |
C2-3068HCL | Recombinant Human C2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All C2 Products
Required fields are marked with *
My Review for All C2 Products
Required fields are marked with *
0
Inquiry Basket