Recombinant Golden hamster B2m protein
Cat.No. : | B2m-533G |
Product Overview : | Recombinant Golden hamster B2m protein(A0A1U7QLF7)(21-119aa) was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Golden hamster |
Source : | E.coli |
Tag : | Non |
Protein Length : | 21-119a.a. |
Tag : | Non |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 11.9 kDa |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | IQRPPQVQVYTRHPPEDGKPNFLNCYVSQFHPPHIEIELLKNGEKMDKVELSDLSFNKDWSFYLLAHREFVPTATDKYACRVSHITLKEPKVVTWERDM |
◆ Recombinant Proteins | ||
B2M-315H | Recombinant Human B2M Protein, His-tagged | +Inquiry |
B2M-27H | Recombinant Human B2M Protein, C-6His-Avi tagged, Biotinylated | +Inquiry |
B2M-0236H | Recombinant Human B2M Protein (Ile21-Met119), C-His-tagged | +Inquiry |
B2M-0233H | Recombinant Human B2M Protein (Gln22-Met119), N-His-tagged | +Inquiry |
B2M-1146C | Recombinant Chicken B2M | +Inquiry |
◆ Native Proteins | ||
B2M-8046H | Native Human Beta 2 MicroGlobulin | +Inquiry |
B2M-13H | Native Human B2M | +Inquiry |
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
◆ Cell & Tissue Lysates | ||
B2M-1512CCL | Recombinant Cynomolgus B2M cell lysate | +Inquiry |
B2M-1550RCL | Recombinant Rat B2M cell lysate | +Inquiry |
B2M-2204HCL | Recombinant Human B2M cell lysate | +Inquiry |
B2M-1656MCL | Recombinant Mouse B2M cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All B2m Products
Required fields are marked with *
My Review for All B2m Products
Required fields are marked with *