Recombinant Golden hamster CLU protein, His&Myc-tagged
Cat.No. : | CLU-642G |
Product Overview : | Recombinant Golden hamster CLU protein(P14683)(1-191aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Golden hamster |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 1-191aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 29.5 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | NRRPHFLYPKSRLIRSLLPPPHYGPLSFHDMFQPFLEMIHQAQQAMDVQFHSPAFQFPDMDLLREGEDDRAVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSANNPAQAHLRQELNDSLQVAERLTQRYNELLHSLQTKMLNTSSLLEQLNEQFNWVSQLANLTQGEDQYYLRVSTVTTHSSDSEVPSRVT |
◆ Recombinant Proteins | ||
CLU-11058Z | Recombinant Zebrafish CLU | +Inquiry |
Clu-039M | Recombinant Mouse Clu Protein, His-tagged | +Inquiry |
CLU-11H | Recombinant Human CLU protein, His-tagged | +Inquiry |
CLU-803H | Recombinant Human CLU Protein, His&GST-tagged | +Inquiry |
CLU-1743H | Recombinant Human CLU Protein (Asp23-Glu449), C-His tagged | +Inquiry |
◆ Native Proteins | ||
CLU-19H | Native Human Clusterin Protein | +Inquiry |
CLU-67H | Native Human Clusterin | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *