Recombinant Golden hamster CLU protein, His&Myc-tagged
| Cat.No. : | CLU-642G |
| Product Overview : | Recombinant Golden hamster CLU protein(P14683)(1-191aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Golden hamster |
| Source : | E.coli |
| Tag : | His&Myc |
| Protein Length : | 1-191aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 29.5 kDa |
| Purity : | Greater than 85% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
| AA Sequence : | NRRPHFLYPKSRLIRSLLPPPHYGPLSFHDMFQPFLEMIHQAQQAMDVQFHSPAFQFPDMDLLREGEDDRAVCKEIRHNSTGCLKMKGQCEKCQEILSVDCSANNPAQAHLRQELNDSLQVAERLTQRYNELLHSLQTKMLNTSSLLEQLNEQFNWVSQLANLTQGEDQYYLRVSTVTTHSSDSEVPSRVT |
| ◆ Recombinant Proteins | ||
| Clu-2679R | Recombinant Rat Clusterin, T7-His | +Inquiry |
| Clu-108R | Recombinant Rattus Clusterin, His-tagged, T7-tagged | +Inquiry |
| CLU-223H | Recombinant Human CLU, C13&N15-labeled | +Inquiry |
| CLU-2751H | Recombinant Human CLU Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CLU-1130R | Recombinant Rat CLU Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Native Proteins | ||
| CLU-67H | Native Human Clusterin | +Inquiry |
| CLU-19H | Native Human Clusterin Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLU-2195MCL | Recombinant Mouse CLU cell lysate | +Inquiry |
| CLU-2198HCL | Recombinant Human CLU cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLU Products
Required fields are marked with *
My Review for All CLU Products
Required fields are marked with *
