Recombinant Golden hamster IL12B protein, His&Myc-tagged
Cat.No. : | IL12B-7476G |
Product Overview : | Recombinant Golden hamster IL12B protein(Q8CJE6)(23-327aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Golden hamster |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 23-327a.a. |
Tag : | His&Myc |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 39.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | IWELEKDVYVVEVDWSPDAAGERVVLTCDTSEEDDIIWTSDKNSEAVGSGKTLTIQVKEFSNAGQYTCHKGGKTLSHSRLLLHKKENGIWSTDILKDQKDPKNKTFLKCEAANYSGRFTCWWLTAISTDLKFNVKSSSSSSDSRAVTCGAASLSAEKVTVDRKDYQKYSVACQEDITCPTAEETLPIGLVMEAQHKYKYENYSTGFFIRDIIKPDPPKNLQLKPLRGSQMELSWEYPDSWSTPHSYFSLKFHVQVHRKRERKDESQFVDKTSATIRCSKGAEVRVRAQDHYYNSSWSRWVSVPCS |
◆ Recombinant Proteins | ||
Il12b-5647M | Active Recombinant Mouse Interleukin 12b, His-tagged | +Inquiry |
Il12b-257I | Active Recombinant Mouse Il12b Protein | +Inquiry |
IL12B-014F | Recombinant Ferret IL12B Protein, Met1-Ser329, C-His tagged | +Inquiry |
IL12B-4303H | Recombinant Human IL12B Protein (Met1-Ser328), C-His tagged | +Inquiry |
Il12b-020H | Recombinant Hamster Il12b Protein, Met1-Ser327, C-His tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL12B-1101MCL | Recombinant Mouse IL12B cell lysate | +Inquiry |
IL12B-1000MCL | Recombinant Marmoset IL12B cell lysate | +Inquiry |
IL12B-2731HCL | Recombinant Human IL12B cell lysate | +Inquiry |
IL12B-1197RCL | Recombinant Rat IL12B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IL12B Products
Required fields are marked with *
My Review for All IL12B Products
Required fields are marked with *
0
Inquiry Basket