Recombinant Guinea Pig CXCL10 Protein

Cat.No. : CXCL10-54G
Product Overview : Recombinant Guinea Pig CXCL10 Protein without tag was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Guinea Pig
Source : E.coli
Description : Interferon gamma-induced protein 10 (IP-10), or CXCL10, is a chemokine secreted by monocytes, endothelial cells and fibroblasts in response to interferon gamma (IFN-‰£). IP-10 functions as a chemoattractant for activated T cells, monocytes, dendritic, and natural killer (NK) cells that express the G protein-coupled receptor CXCR3. IP-10 is an important factor in autoimmune diseases such as Hashimoto’s thyroiditis, Graves’ disease, and Type 1 diabetes mellitus.
Bio-activity : No biological activity data is available at this time.
Molecular Mass : Monomer, 8.7 kDa (76 aa)
AA Sequence : IPHSRTIRCTCIETSTQPVNPKSFKKLEIIPASQSCPRVEIIATMKMNGEKRCLDPESKVIKNLLKAVRKERSKRS
Endotoxin : ≤1 EUs/μg, Kinetic LAL
Purity : ≥95%, Reducing and Non-Reducing SDS PAGE
Stability : 12 months from date of receipt when stored at -20 to -80 centigrade as supplied.
1 month when stored at 4 centigrade after reconstituting as directed.
3 months when stored at -20 to -80 centigrade after reconstituting as directed.
Storage : Storage Prior to Reconstitution: -20 centigrade
Storage Buffer : Lyophilized from a sterile (0.2 micron) filtered aqueous solution containing 0.1% Trifluoroacetic Acid (TFA)
Reconstitution : Sterile water at 0.1 mg/mL
Shipping : Room temperature
Instructions : Centrifuge vial before opening. Suspend the product by gently pipetting the above recommended solution down the sides of the vial. DO NOT VORTEX. Allow several minutes for complete reconstitution. For prolonged storage, dilute to working aliquots in a 0.1% BSA solution, store at -80 centigrade and avoid repeat freeze thaws.
Gene Name Cxcl10 C-X-C motif chemokine ligand 10 [ Cavia porcellus (domestic guinea pig) ]
Official Symbol CXCL10
Synonyms Cxcl10; C-X-C motif chemokine ligand 10; C-X-C motif chemokine 10
Gene ID 100714889
mRNA Refseq XM_003477649
Protein Refseq XP_003477697
UniProt ID A0A286XCT1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CXCL10 Products

Required fields are marked with *

My Review for All CXCL10 Products

Required fields are marked with *

0
cart-icon