Recombinant Guinea pig IL23A protein, His&Myc-tagged
Cat.No. : | IL23A-4326G |
Product Overview : | Recombinant Guinea pig IL23A protein(Q6LA37)(20-189aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Guinea pig |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 20-189aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 26.2 kDa |
AA Sequence : | RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Storage : | Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
Gene Name | Il23a interleukin 23, alpha subunit p19 [ Cavia porcellus ] |
Official Symbol | IL23A |
Synonyms | IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL-23-A; IL-23p19; IL-23 p19 subunit; IL-23 subunit alpha; Interleukin-23 p19 subunit; interleukin-23 subunit p19; |
Gene ID | 100135557 |
mRNA Refseq | NM_001172969 |
Protein Refseq | NP_001166440 |
◆ Recombinant Proteins | ||
IL23A-1327P | Recombinant Pig IL23A Full Length Transmembrane protein, His&Myc-tagged | +Inquiry |
IL23a-3326R | Recombinant Rat IL23a protein, His-tagged | +Inquiry |
Il23A-003H | Active Recombinant Human Il23A, HIgG1 Fc-tagged | +Inquiry |
IL23A-4846H | Recombinant Human IL23A Protein (Arg20-Pro189), C-His tagged | +Inquiry |
Il23a-2305M | Recombinant Mouse Il23a Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IL23A-5231HCL | Recombinant Human IL23A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (1)
Ask a Question for All IL23A Products
Required fields are marked with *
My Review for All IL23A Products
Required fields are marked with *