Recombinant Guinea pig IL23A protein, His&Myc-tagged

Cat.No. : IL23A-4326G
Product Overview : Recombinant Guinea pig IL23A protein(Q6LA37)(20-189aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Guinea pig
Source : E.coli
Tag : His&Myc
Protein Length : 20-189aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 26.2 kDa
AA Sequence : RAVSGSSNPSWTQCQQLSQKLCTLAWSAHPSVGHVEPPREEADEETTDYVPHILCGDGCDPQGLKDNSQFCLQRIYQGLVFYQNLLGSDIFTGEPPLFPDGPVSQLHASLLGLSQLLQPEVHQWEPQIPSLSPNQPWQRLLLRIKILRSFQAFVAVAARVFGHGAATLTP
Purity : Greater than 90% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name Il23a interleukin 23, alpha subunit p19 [ Cavia porcellus ]
Official Symbol IL23A
Synonyms IL23A; interleukin 23, alpha subunit p19; interleukin-23 subunit alpha; IL-23-A; IL-23p19; IL-23 p19 subunit; IL-23 subunit alpha; Interleukin-23 p19 subunit; interleukin-23 subunit p19;
Gene ID 100135557
mRNA Refseq NM_001172969
Protein Refseq NP_001166440

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All IL23A Products

Required fields are marked with *

My Review for All IL23A Products

Required fields are marked with *

0
cart-icon
0
compare icon